KEGG   Sphingomonas wittichii: Swit_1413Help
Entry
Swit_1413         CDS       T00538                                 

Definition
(GenBank) L-threonine synthase
  KO
K01733  threonine synthase [EC:4.2.3.1]
Organism
swi  Sphingomonas wittichii
Pathway
swi00260  Glycine, serine and threonine metabolism
swi00750  Vitamin B6 metabolism
swi01100  Metabolic pathways
swi01110  Biosynthesis of secondary metabolites
swi01120  Microbial metabolism in diverse environments
swi01230  Biosynthesis of amino acids
Module
swi_M00018  Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:swi00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Swit_1413
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    Swit_1413
Enzymes [BR:swi01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     Swit_1413
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thr_synth_N PALP Caud_tail_N
Motif
Other DBs
NCBI-ProteinID: ABQ67777
JGI: Swit1413
UniProt: A5V661
Position
1553049..1554449
Genome map
AA seq 466 aa AA seqDB search
MQYVSTRGSAPRLGFEDVTLAGLAADGGLYVPEQWPVFSTAEIAALRGLSYVDTAVAVMK
PFVAGALDDAELKELCEAAYGRFAHAAVVPLKQLDHRQWLMELFHGPTLAFKDVALQLLG
LLFERFLAKRDTHLTVIGATSGDTGSAAIDALAGRAKVDIFMLHPKGRVSEVQRRQMTTV
LAPNVHNIAIEGSFDDAQALVKAMFADADFAGRFNLSAVNSINWARLMAQVVYYFYAAVR
LGAPDRPVAFSVPTGNFGDVFAGYVAARMGLPVARLIVATNVNDILHRALSAGDYSVGTV
TPTAAPSMDIQVSSNFERLLFDLHGRDGAATAATMEGFEASRRLDIPATMRAEAAGLFSS
ARIDADRMQIAMRWAHDRAVETIDPHSAIGLAAAQDSDLDPSIPIVTLATAHPAKFGDAV
ERATGTRPTLPARIGELFERQERYAVLPAEIGAIEGFVAEQAATAA
NT seq 1401 nt NT seq  +upstreamnt  +downstreamnt
atgcagtatgtcagcaccaggggctcggccccgcgcctcggattcgaagacgtcacgctc
gcgggactcgcggcggacggcggcctctatgtgcccgaacaatggccggtcttctcgacc
gccgagatcgcggcgctgcgcggcctgtcctatgtcgacaccgccgtcgcggtgatgaag
ccgttcgtcgccggcgcgctcgacgatgccgagctgaaggagctgtgcgaggccgcctat
ggccgcttcgcccatgccgcggtggtgccgctcaagcagctcgaccatcgccagtggctg
atggagctgttccacggcccgacgctcgccttcaaggacgtcgcgctccagctgctcggc
ctgctgttcgagcgcttcctggcgaagcgcgacacccacctgaccgtgatcggcgcgacc
agcggcgacaccggctcggccgcgatcgacgcgctggccggccgcgccaaggtcgacatc
ttcatgctccaccccaagggccgcgtgtccgaggtgcagcgccggcagatgacgaccgtg
ctggcccccaacgtccacaacatcgcgatcgagggcagcttcgacgacgcccaggcgctg
gtgaaggcgatgttcgccgacgccgacttcgccgggcgcttcaacctgtcggcggtcaat
tcgatcaactgggcccggctgatggcgcaggtggtctattatttctacgccgccgtccgc
ctcggcgcgcccgaccggccggtcgccttctcggtcccgaccggcaatttcggcgacgtg
ttcgcgggctatgtcgcggccaggatgggcctgccggtcgcgcggctgatcgtcgcgacc
aacgtcaacgacatcctccaccgcgcgctgtcggccggcgactattcggtcggcacggtg
acgccgaccgcggcgccgtcgatggacatccaggtcagctccaatttcgagcggctgctg
ttcgacctgcacggccgcgacggcgccgcgacggcggcgacgatggaggggttcgaggcg
agcaggcggctcgacatccccgcgacgatgcgggccgaggcggccgggctgttctcgagc
gcccggatcgacgccgaccggatgcagatcgcgatgcgctgggcgcatgaccgcgcggtc
gagacgatcgacccgcacagcgcgatcggcctcgccgccgcgcaggacagcgatctcgat
ccctcgatcccgatcgtcaccctcgccaccgcgcaccccgccaagttcggcgacgcggtc
gagcgcgccaccggcacccgcccgaccctgcccgcccggatcggcgagctgttcgagcgg
caggagcgctacgccgtcctccccgcagagatcggcgcgatcgagggcttcgtcgccgaa
caggccgcgacggcggcctga

DBGET integrated database retrieval system