KEGG   Sphingomonas wittichii: Swit_1860Help
Entry
Swit_1860         CDS       T00538                                 

Definition
hypothetical protein
Orthology
K16051  
3-oxo-5alpha-steroid 4-dehydrogenase [EC:1.3.99.5]
Organism
swi  Sphingomonas wittichii
Pathway
Steroid degradation
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:swi00001]
 Metabolism
  Xenobiotics biodegradation and metabolism
   00984 Steroid degradation
    Swit_1860
Enzymes [BR:swi01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.99  With other, unknown, acceptors
    1.3.99.5  3-oxo-5alpha-steroid 4-dehydrogenase (acceptor)
     Swit_1860
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2083272..2084930
Genome map
AA seq 552 aa AA seqDB search
MKVDDPNWHSRVEAPFEAGPPDGIAWDDAADVVVVGLGGAGICAALEALHQGARVIAIDR
FGGGGATRMSGGVYYSGGGTRYQKAAGVEDDAEQMYRYLKMEVADAVADETLRHFCETSS
ESIDWLARHGVRFDGALSPVKTSYPGAGRFLYYSGNEAQADYADHARPAQRGHRVVGEGL
TGHRFFDPLLQAALDMGLKLYGYSEARRFILSDDGGIAGIQIQHVDAASSSAAKLGKIAR
KFARASTLLFPSIAERLVREANGISDRDGATRSIRIDKAVVLAAGGYIHNRKMVAHYAPR
YTGAIPLGSIGCDGSGIRLGQSVGARTDRLDNISAWRQFNPPAAFPTGIVVNGRGERFVA
EDCYGGKIGHHIAEDQGGVAYIILDDRLRRRALTEAMPGKGKLFRLQGAPALMGLFLSAK
RAATLEALAARCGMDPAALRASVEHYNRASAGLEEPRFRKHPDFVGEIVEPPFHAVDISI
HNRKYLCPSISLGGIVVDEKTGQALDEAGRPIPKLFAAGKNAKGLSSHRYVSGISLADCV
YSGRIAGRSASR
NT seq 1659 nt NT seq  +upstreamnt  +downstreamnt
atgaaggtcgacgatcccaactggcattcccgcgtggaagccccgttcgaggcggggccc
cccgacggcattgcctgggacgacgcggcggacgtcgtcgtcgtcgggctgggcggcgcg
ggaatctgcgccgcgctggaggcgctccaccagggcgcgcgggtgatcgcgatcgaccgg
ttcggcggcggcggggcgacccgcatgtccgggggcgtctattatagcggcggggggact
cgctaccagaaggcggccggcgtcgaggacgacgcggagcagatgtaccgctatctgaag
atggaggtcgccgacgccgtcgccgacgagacgctccgccatttctgcgagaccagcagc
gagagcatcgactggctggccaggcacggcgtgcggttcgacggcgcgctctccccggtc
aagacctcctatcccggcgcgggccgcttcctctattattcgggcaacgaggcgcaggcg
gactatgccgatcacgcccggcccgcgcagcgcggccaccgcgtcgtcggcgaggggctg
accgggcatcgcttcttcgatccgctgctgcaggccgcgctcgacatggggctgaagctc
tacggctacagcgaggcgcggcgcttcatcctgtccgacgacggcgggatcgccggcatc
cagatccagcatgtcgacgcggcatcgtcctccgcggcgaagctcggcaagatcgcgcgg
aagttcgccagggcgtcgaccctgctgttcccgagcatcgccgaacggctggtgcgcgaa
gcgaacggcatctccgacagggacggcgcgacccgctcgatccggatcgacaaggcggtg
gtgctcgcggccggcggctatatccacaaccgcaagatggtcgcccactacgcgccgcgc
tacaccggcgcgatcccgctcggcagcatcggctgcgacggatcggggatcaggctcggc
cagtcggtcggcgcccggaccgaccggctcgacaacatctcggcctggcggcagttcaac
ccgcccgccgccttcccgaccggcatcgtcgtcaacggccggggcgagcgcttcgtcgcc
gaggattgctatggcggcaagatcggccatcacatcgccgaggaccagggcggggtcgcc
tatatcatcctcgacgaccggctccgccgccgggcgctgacggaggcgatgccgggcaag
ggcaagctgttccggctccagggcgcgccggcgctgatgggtctcttcctgagcgcgaag
agggccgccaccctcgaagcgctcgccgcccgatgcggcatggacccggcggcgctgcgg
gcctcggtcgagcattacaaccgcgcgtcggccgggctggaggagccccgtttccgcaag
catcccgacttcgtcggcgagatcgtcgagccgcccttccacgcggtcgacatctcgatc
cacaacaggaaatatctgtgcccttcgatctcgctgggcggcatcgtcgtcgacgagaag
accggccaggcgctcgacgaggcgggccggccgatccccaaattgttcgcggcgggcaag
aacgccaagggcctgtcctcgcatcgctatgtcagcggcatctcgctcgccgactgcgtc
tattcggggcggatcgcaggccgttcggccagccgatga

DBGET integrated database retrieval system