KEGG   Sphingomonas wittichii: Swit_1937Help
Entry
Swit_1937         CDS       T00538                                 

Definition
uroporphyrinogen III synthase HEM4
Orthology
K01719  
uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
swi  Sphingomonas wittichii
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:swi00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Swit_1937
Enzymes [BR:swi01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.75  uroporphyrinogen-III synthase
     Swit_1937
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2170606..2171295
Genome map
AA seq 229 aa AA seqDB search
MSRPPLLILRPEPGASMTAKRAFGEGWRPVVSPIFRIEPIAWGAPPAGDYDALFVTSANA
VRQAGKAIRPYAVIPAYAVGDATARALKAAGFTDIHTGRGDAAAMLETAAANGVARALHL
AGEDHRDAGLDAIAIDRRIVYRSAAIERFGDKALAALREGGGAVLLHSGRAAEHFARLCD
GARISRRHVRIAALAPAVLDAAGSGWRAGIAADKPDDAALLAAAARLCQ
NT seq 690 nt NT seq  +upstreamnt  +downstreamnt
atgagtcgtccgcccctgctgatcctccgccccgaaccgggcgcgagcatgaccgccaag
cgcgcgttcggcgaaggctggcgcccggtcgtctcgccgatcttccggatcgagccgatc
gcctggggcgcgccgcccgccggcgattatgacgcgctgttcgtcaccagcgccaacgcc
gtgcgccaggccggcaaggcgatccggccctatgccgtcatcccggcctatgcggtcggc
gacgcgaccgcccgcgcgctgaaggcggcgggcttcaccgacatccacaccgggcgcggc
gacgcggcggcgatgctggagaccgccgccgcgaacggcgtcgcccgcgcgctgcacctc
gccggcgaggatcatcgcgacgccgggctcgacgcgatcgcgatcgaccggcggatcgtc
tatcgcagcgcggcgatcgaacggttcggcgacaaggcgctggccgcgctgcgcgagggc
ggcggcgcggtgctgctccattcgggccgggccgccgagcatttcgcccggctgtgcgac
ggcgcgcggatttcgcgccgccatgtcaggatcgccgccttggccccggcggtgctcgac
gcggccggctccggctggcgcgccgggatcgccgccgacaagccggacgacgcggcgctg
ctggcggcggcggcgcggctgtgtcaataa

DBGET integrated database retrieval system