KEGG   Sphingomonas wittichii: Swit_1937Help
Entry
Swit_1937         CDS       T00538                                 

Definition
uroporphyrinogen III synthase HEM4
Orthology
K01719  
uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
swi  Sphingomonas wittichii
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of cofactors and vitamins; Porphyrin and chlorophyll metabolism [PATH:swi00860]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2170606..2171295
Genome map
AA seq 229 aa AA seqDB search
MSRPPLLILRPEPGASMTAKRAFGEGWRPVVSPIFRIEPIAWGAPPAGDYDALFVTSANA
VRQAGKAIRPYAVIPAYAVGDATARALKAAGFTDIHTGRGDAAAMLETAAANGVARALHL
AGEDHRDAGLDAIAIDRRIVYRSAAIERFGDKALAALREGGGAVLLHSGRAAEHFARLCD
GARISRRHVRIAALAPAVLDAAGSGWRAGIAADKPDDAALLAAAARLCQ
NT seq 690 nt NT seq  +upstreamnt  +downstreamnt
atgagtcgtccgcccctgctgatcctccgccccgaaccgggcgcgagcatgaccgccaag
cgcgcgttcggcgaaggctggcgcccggtcgtctcgccgatcttccggatcgagccgatc
gcctggggcgcgccgcccgccggcgattatgacgcgctgttcgtcaccagcgccaacgcc
gtgcgccaggccggcaaggcgatccggccctatgccgtcatcccggcctatgcggtcggc
gacgcgaccgcccgcgcgctgaaggcggcgggcttcaccgacatccacaccgggcgcggc
gacgcggcggcgatgctggagaccgccgccgcgaacggcgtcgcccgcgcgctgcacctc
gccggcgaggatcatcgcgacgccgggctcgacgcgatcgcgatcgaccggcggatcgtc
tatcgcagcgcggcgatcgaacggttcggcgacaaggcgctggccgcgctgcgcgagggc
ggcggcgcggtgctgctccattcgggccgggccgccgagcatttcgcccggctgtgcgac
ggcgcgcggatttcgcgccgccatgtcaggatcgccgccttggccccggcggtgctcgac
gcggccggctccggctggcgcgccgggatcgccgccgacaagccggacgacgcggcgctg
ctggcggcggcggcgcggctgtgtcaataa

DBGET integrated database retrieval system