KEGG   Sphingomonas wittichii: Swit_2596Help
Entry
Swit_2596         CDS       T00538                                 

Definition
diguanylate cyclase
Orthology
K13590  
diguanylate cyclase
Organism
swi  Sphingomonas wittichii
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(2879152..2880183)
Genome map
AA seq 343 aa AA seqDB search
MKEERIAEKSAARAEWRRLYDMIGKLLFDHGLEPSPANFELCHRYLSGRDAALNATIDRA
IAKDGGLTDAVAGTIATRLDPGLSTDELSRMALEAQGYLEQMTTILARSGEDARDYGEAL
AHEAEGLAADGSPALAVKKLVGLTRTMIDKAQAAEEDLRRTEQQMSAMRKDLAAAHRKAN
SDPLTGLPNRRALDQHLRGAFENARRAATPLALAICDIDHFKQFNDTHGHQIGDEVIKFV
ASSLGRAASGDVFVARYGGEEFVMVFERGAAAKAMATLDKIRAAIAARELKVTHTGQSLG
RLSFSGGLAALDLQDSPGSILKRADAALYRAKQDGRNRIHAAE
NT seq 1032 nt NT seq  +upstreamnt  +downstreamnt
gtgaaagaagaaagaatagccgagaagtctgctgcgcgcgccgaatggcggcgtctgtac
gacatgatcggcaagcttctgttcgatcacgggctggaaccgtccccggcgaatttcgaa
ttgtgccaccgctatctgtcgggtcgcgacgctgcgctcaacgcgacgatcgaccgcgcg
atcgccaaggacggcgggctgaccgacgccgtcgccggtacgatcgccacccggctggac
cccggcctgtcgaccgacgaactgtcgcgcatggcgctggaggcgcagggctatctcgag
cagatgacgacgatcctcgcccgctcgggcgaggacgcgcgcgactatggcgaggcgctg
gcgcacgaggccgaggggctggcggcggacggatcgcccgcgctcgcggtcaagaagctg
gtcggcctgacccggacgatgatcgacaaggcgcaggcggccgaggaggacctgcgccgc
accgagcagcagatgagcgcgatgcgcaaggacctcgccgcggcgcatcgcaaggcgaac
agcgatccgctcaccggcctgcccaaccgccgcgcgctcgaccagcatctgcgcggcgcg
ttcgagaatgcccgccgcgccgccacgccgctcgcgctggcgatctgcgacatcgaccat
ttcaagcagttcaacgacacccatggccaccagatcggcgacgaggtgatcaagttcgtc
gcctcctcgctcggccgcgccgccagcggcgacgtgttcgtcgcgcgctatggcggcgag
gaattcgtgatggtgttcgagcgtggcgccgccgccaaggcgatggcgaccctcgacaag
atccgcgccgcgatcgccgcgcgcgagctcaaggtgacgcacaccggccagtcgctcggc
cggctgagcttctcgggcgggctcgccgcgctcgatctccaggattcgccgggctcgatc
ctcaagcgcgccgacgccgcgctctaccgggccaagcaggacggccgcaaccgcatccac
gcggcggagtga

DBGET integrated database retrieval system