KEGG   Sphingomonas wittichii: Swit_2596Help
Entry
Swit_2596         CDS       T00538                                 

Definition
(GenBank) diguanylate cyclase
  KO
K13590  
diguanylate cyclase [EC:2.7.7.65]
Organism
swi  Sphingomonas wittichii
Brite
Enzymes [BR:swi01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.65  diguanylate cyclase
     Swit_2596
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
complement(2879152..2880183)
Genome map
AA seq 343 aa AA seqDB search
MKEERIAEKSAARAEWRRLYDMIGKLLFDHGLEPSPANFELCHRYLSGRDAALNATIDRA
IAKDGGLTDAVAGTIATRLDPGLSTDELSRMALEAQGYLEQMTTILARSGEDARDYGEAL
AHEAEGLAADGSPALAVKKLVGLTRTMIDKAQAAEEDLRRTEQQMSAMRKDLAAAHRKAN
SDPLTGLPNRRALDQHLRGAFENARRAATPLALAICDIDHFKQFNDTHGHQIGDEVIKFV
ASSLGRAASGDVFVARYGGEEFVMVFERGAAAKAMATLDKIRAAIAARELKVTHTGQSLG
RLSFSGGLAALDLQDSPGSILKRADAALYRAKQDGRNRIHAAE
NT seq 1032 nt NT seq  +upstreamnt  +downstreamnt
gtgaaagaagaaagaatagccgagaagtctgctgcgcgcgccgaatggcggcgtctgtac
gacatgatcggcaagcttctgttcgatcacgggctggaaccgtccccggcgaatttcgaa
ttgtgccaccgctatctgtcgggtcgcgacgctgcgctcaacgcgacgatcgaccgcgcg
atcgccaaggacggcgggctgaccgacgccgtcgccggtacgatcgccacccggctggac
cccggcctgtcgaccgacgaactgtcgcgcatggcgctggaggcgcagggctatctcgag
cagatgacgacgatcctcgcccgctcgggcgaggacgcgcgcgactatggcgaggcgctg
gcgcacgaggccgaggggctggcggcggacggatcgcccgcgctcgcggtcaagaagctg
gtcggcctgacccggacgatgatcgacaaggcgcaggcggccgaggaggacctgcgccgc
accgagcagcagatgagcgcgatgcgcaaggacctcgccgcggcgcatcgcaaggcgaac
agcgatccgctcaccggcctgcccaaccgccgcgcgctcgaccagcatctgcgcggcgcg
ttcgagaatgcccgccgcgccgccacgccgctcgcgctggcgatctgcgacatcgaccat
ttcaagcagttcaacgacacccatggccaccagatcggcgacgaggtgatcaagttcgtc
gcctcctcgctcggccgcgccgccagcggcgacgtgttcgtcgcgcgctatggcggcgag
gaattcgtgatggtgttcgagcgtggcgccgccgccaaggcgatggcgaccctcgacaag
atccgcgccgcgatcgccgcgcgcgagctcaaggtgacgcacaccggccagtcgctcggc
cggctgagcttctcgggcgggctcgccgcgctcgatctccaggattcgccgggctcgatc
ctcaagcgcgccgacgccgcgctctaccgggccaagcaggacggccgcaaccgcatccac
gcggcggagtga

DBGET integrated database retrieval system