KEGG   Sphingomonas wittichii: Swit_2726Help
Entry
Swit_2726         CDS       T00538                                 

Definition
(GenBank) tryptophan synthase, beta chain
  KO
K01696  tryptophan synthase beta chain [EC:4.2.1.20]
Organism
swi  Sphingomonas wittichii
Pathway
swi00260  Glycine, serine and threonine metabolism
swi00400  Phenylalanine, tyrosine and tryptophan biosynthesis
swi01100  Metabolic pathways
swi01110  Biosynthesis of secondary metabolites
swi01130  Biosynthesis of antibiotics
swi01230  Biosynthesis of amino acids
Module
swi_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:swi00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Swit_2726
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Swit_2726
Enzymes [BR:swi01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Swit_2726
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP
Motif
Other DBs
NCBI-ProteinID: ABQ69082
JGI: Swit2726
UniProt: A5V9W6
Position
3008622..3009851
Genome map
AA seq 409 aa AA seqDB search
MNAPNASPRPNTLRNGPDEQGQFGQFGGRYVSETLMPLILDLEREYRAAQADPAFRAELD
DLMRHYVGRPSPLYYAERLTEHLGGAKIYLKREELNHTGAHKINNCIGQILLARRMGKTR
IIAETGAGQHGVATATVAARFGLPCTIFMGAVDVARQQPNVFRMKLLGAEVNAVTSGAQT
LKDAMNEALRDWVANVHDTFYIIGTAAGPHPYPELVRDFQSVIGHEARAQILEAEGRLPD
MLIAAVGGGSNAIGLFHPFLDDAGVRMIGVEAAGEGLDTDKHAASLAGGSPGVLHGNRTY
LLQDDDGQITEAHSISAGLDYPGIGPEHSWLHEIGRAEYHPVTDAEALASFQRLARLEGI
IPALESAHALAAVEKLAPTMGKDQLIVLNLSGRGDKDIFTVAAALGVEI
NT seq 1230 nt NT seq  +upstreamnt  +downstreamnt
atgaacgccccaaatgccagcccgcgtcccaacacgctgaggaacggtcccgacgagcag
ggccagttcggccagttcggcggccgctacgtcagcgagacgctgatgccgctgatcctc
gacctcgaacgcgaatatcgcgcggcgcaggccgaccccgccttccgggccgagctcgac
gacctgatgcgccattatgtcggccggccgagcccgctctattatgccgagcggctgacc
gagcatctcggcggcgcgaagatctacctgaagcgcgaggagctgaaccacaccggcgcg
cacaagatcaacaactgcatcggccagatcctgctcgcccgccgcatgggcaagacccgg
atcatcgccgagactggcgccggccagcacggcgtcgccaccgccaccgtcgcggcgcgc
ttcggcctgccctgcaccatcttcatgggcgcggtcgacgtcgcgcggcagcagcccaac
gtgttccgcatgaagctgctcggcgccgaggtgaacgccgtcacctcgggcgcgcagacg
ctcaaggatgcgatgaacgaggcgctgcgcgactgggtcgcgaacgtccacgacaccttc
tacatcatcggcaccgccgccggcccccatccctatcccgagctggtccgcgacttccag
tcggtgatcggccacgaggcgcgcgcgcagatcctggaggccgaggggcgcctgcccgac
atgctgatcgcggcggtcggcggcggctccaacgcgatcggcctgttccaccccttcctc
gacgacgccggagtgcggatgatcggggtcgaggcggcgggcgaagggctcgacaccgac
aagcatgccgccagcctcgccggcgggtcgcccggcgtgctccacggcaaccgcacctat
ctgctccaggacgatgacggccagatcaccgaggcgcactcgatctcggccgggctcgac
tatccggggatcggccccgaacatagctggctgcacgagatcggccgcgccgaatatcac
cccgtcaccgacgccgaggcgctcgccagcttccagcggctcgcccggctggaagggatc
atccccgctctcgaatcggcgcacgcgctggcggcggtcgagaagctcgcgccgacgatg
ggcaaggaccagctgatcgtcctcaacctgtcgggccgcggcgacaaggacatcttcacc
gtcgccgccgcgctgggggtcgagatatga

DBGET integrated database retrieval system