KEGG   Sphingomonas wittichii: Swit_2861Help
Entry
Swit_2861         CDS       T00538                                 

Definition
UDP-glucose pyrophosphorylase (EC:2.7.7.9)
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
swi  Sphingomonas wittichii
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:swi00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    Swit_2861
   00052 Galactose metabolism
    Swit_2861
   00500 Starch and sucrose metabolism
    Swit_2861
   00520 Amino sugar and nucleotide sugar metabolism
    Swit_2861
Enzymes [BR:swi01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     Swit_2861
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(3142877..3143746)
Genome map
AA seq 289 aa AA seqDB search
MKPVRKAIFPVAGFGTRFLPATKAVPKEMLPVVDRPLIQYAVDEARAAGIEQMIFVTGRN
KYAIEDYFDSAYEIESDLAAKNKTSFLDKLEATRLSPGKAAFVRQQQMLGLGHAVACARD
LVGDEPFAVLLPDELLWNPASPCLKQMADTYARTGGNVVAVLEVPEDQTHKYGIVDPGAA
EGAVTEVRKMVEKPAAGTAPSRLAIVGRYILQPEIFALLDKGERGAGGEIQLTDAMAKLI
GTQPFHALTFDGERHDCGDNAGFIQANIALALERPEIADSVRAFIRTLV
NT seq 870 nt NT seq  +upstreamnt  +downstreamnt
atgaagcccgtccgcaaggccatctttcccgtcgccggtttcggcacccgcttcctgccc
gccaccaaggccgtccccaaggagatgctgccggtcgtcgaccggccgctgatccagtac
gccgtcgacgaggcgcgcgcggcggggatcgagcagatgatcttcgtcaccggccgcaac
aaatatgcgatcgaggactatttcgactcggcctatgagatcgagagcgatctcgccgcc
aagaacaagacgagcttcctcgacaagctcgaagcgacccggctgtcgcccggcaaggcc
gccttcgtccgccagcagcagatgctgggcctcggccatgccgtcgcctgcgcgcgcgac
ctggtcggcgacgagccgttcgcggtgctgctgcccgacgagctgctgtggaacccggcg
tcgccctgcctgaagcagatggccgacacctatgcgcgcaccggcggcaacgtcgtcgcg
gtgctcgaggtgcccgaggaccagacccacaaatatggcatcgtcgatcccggcgccgcc
gagggcgcggtgaccgaggtgcgcaagatggtcgagaaaccggcggcgggcaccgccccc
tcgcgcctcgccatcgtcggccgctacatcctccagcccgagatcttcgcgctgctcgac
aagggcgagcgcggcgccggtggcgagatccagctcaccgacgcgatggccaagctgatc
ggcacccagcccttccacgctctgaccttcgacggcgagcgccacgattgcggcgacaat
gccggcttcatccaggcgaacatcgcgctggcgctggagcggcccgagatcgccgattcg
gtgcgggcgttcatccggacgctggtgtaa

DBGET integrated database retrieval system