KEGG   Sphingomonas wittichii: Swit_2861Help
Entry
Swit_2861         CDS       T00538                                 

Definition
(GenBank) UDP-glucose pyrophosphorylase
  KO
K00963  UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
swi  Sphingomonas wittichii
Pathway
swi00040  Pentose and glucuronate interconversions
swi00052  Galactose metabolism
swi00500  Starch and sucrose metabolism
swi00520  Amino sugar and nucleotide sugar metabolism
swi01100  Metabolic pathways
swi01130  Biosynthesis of antibiotics
Module
swi_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:swi00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    Swit_2861
   00052 Galactose metabolism
    Swit_2861
   00500 Starch and sucrose metabolism
    Swit_2861
   00520 Amino sugar and nucleotide sugar metabolism
    Swit_2861
Enzymes [BR:swi01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     Swit_2861
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NTP_transferase NTP_transf_3
Motif
Other DBs
NCBI-ProteinID: ABQ69213
JGI: Swit2861
UniProt: A5VA97
Position
complement(3142877..3143746)
Genome map
AA seq 289 aa AA seqDB search
MKPVRKAIFPVAGFGTRFLPATKAVPKEMLPVVDRPLIQYAVDEARAAGIEQMIFVTGRN
KYAIEDYFDSAYEIESDLAAKNKTSFLDKLEATRLSPGKAAFVRQQQMLGLGHAVACARD
LVGDEPFAVLLPDELLWNPASPCLKQMADTYARTGGNVVAVLEVPEDQTHKYGIVDPGAA
EGAVTEVRKMVEKPAAGTAPSRLAIVGRYILQPEIFALLDKGERGAGGEIQLTDAMAKLI
GTQPFHALTFDGERHDCGDNAGFIQANIALALERPEIADSVRAFIRTLV
NT seq 870 nt NT seq  +upstreamnt  +downstreamnt
atgaagcccgtccgcaaggccatctttcccgtcgccggtttcggcacccgcttcctgccc
gccaccaaggccgtccccaaggagatgctgccggtcgtcgaccggccgctgatccagtac
gccgtcgacgaggcgcgcgcggcggggatcgagcagatgatcttcgtcaccggccgcaac
aaatatgcgatcgaggactatttcgactcggcctatgagatcgagagcgatctcgccgcc
aagaacaagacgagcttcctcgacaagctcgaagcgacccggctgtcgcccggcaaggcc
gccttcgtccgccagcagcagatgctgggcctcggccatgccgtcgcctgcgcgcgcgac
ctggtcggcgacgagccgttcgcggtgctgctgcccgacgagctgctgtggaacccggcg
tcgccctgcctgaagcagatggccgacacctatgcgcgcaccggcggcaacgtcgtcgcg
gtgctcgaggtgcccgaggaccagacccacaaatatggcatcgtcgatcccggcgccgcc
gagggcgcggtgaccgaggtgcgcaagatggtcgagaaaccggcggcgggcaccgccccc
tcgcgcctcgccatcgtcggccgctacatcctccagcccgagatcttcgcgctgctcgac
aagggcgagcgcggcgccggtggcgagatccagctcaccgacgcgatggccaagctgatc
ggcacccagcccttccacgctctgaccttcgacggcgagcgccacgattgcggcgacaat
gccggcttcatccaggcgaacatcgcgctggcgctggagcggcccgagatcgccgattcg
gtgcgggcgttcatccggacgctggtgtaa

DBGET integrated database retrieval system