KEGG   Sphingomonas wittichii: Swit_3015Help
Entry
Swit_3015         CDS       T00538                                 

Definition
pyrophosphate-dependent phosphofructokinase (EC:2.7.1.90)
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
swi  Sphingomonas wittichii
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Class
Metabolism; Overview; Carbon metabolism [PATH:swi01200]
Metabolism; Overview; Biosynthesis of amino acids [PATH:swi01230]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:swi00010]
Metabolism; Carbohydrate metabolism; Pentose phosphate pathway [PATH:swi00030]
Metabolism; Carbohydrate metabolism; Fructose and mannose metabolism [PATH:swi00051]
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:swi00052]
Metabolism; Energy metabolism; Methane metabolism [PATH:swi00680]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
3301038..3302138
Genome map
AA seq 366 aa AA seqDB search
MRIGVLTGGGDVPGLNPCIRSIALSALDRGWEVIGFRRGWQGFLEIDPAERESVAAHSIV
LDREAVRGIDRVGGTMLHTSRTDPRTVAGGDRTGHVLMVLDALGVDALITLGGDGTLRFS
AHLSAQGFPVVSIPKTMDNDVFGTDYCIGFSTAITRSVDAINALRTTAESHERIAIVELF
GRRSGETALLAGFLAQVDRTVIAEVPADPDVLLPLLAADRRSRPGAYAMCVISEGAKLAG
DEAEDGDRRLSATRRSETAVSRRLALLIEQRAKEGTIVQQLAYLMRSGDPDALDRMVGFA
FGGLAVQKIEAGETGRMLALRDGNYCHVPIDTLLGGTKTVDVDRLYDRARYRPKLTHVEG
MPMFLY
NT seq 1101 nt NT seq  +upstreamnt  +downstreamnt
atgcgcatcggcgtgctgaccggcggcggcgacgttccggggctcaatccctgcatccgg
tcgatcgcgctgtcggcgctcgatcgcggctgggaggtgatcggcttcaggcgcggctgg
cagggcttcctcgagatcgaccccgccgagcgggagagcgtcgccgcgcacagcatcgtg
ctcgaccgcgaggcggtgcgcgggatcgaccgggtcggcgggacgatgctccacacctcg
cgcaccgacccgcgcaccgtggccggcggcgaccgcaccggccatgtgctcatggtgctc
gacgcgctcggcgtcgacgcgctgatcacgctgggcggcgacgggacgctgcgcttctcg
gcgcatctgtcggcgcagggcttcccggtcgtctcgatccccaagacgatggacaacgac
gtgttcgggaccgactattgcatcggcttctcgaccgcgatcacccgatcggtcgacgcg
atcaacgcgctgcgcaccaccgccgagagccatgagcggatcgcgatcgtcgagctgttc
gggcggcgcagcggggagacggcgctgctcgccggcttcctggcgcaggtcgaccgcacc
gtgatcgccgaggtgccggccgatcccgacgtgctgctgccgctgctcgccgccgatcgc
cgcagccggcccggcgcctatgcgatgtgcgtgatctcggaaggggcgaagctggcgggc
gacgaggcggaggacggcgatcggcggctgtcggcgacgcggcgcagcgagacggcggtc
agccggcggctggcgctgctgatcgagcagcgggcgaaggaggggacgatcgtccagcag
ctcgcctatctgatgcgatcgggcgatcccgacgcgctcgaccggatggtcggcttcgcc
ttcggcggcctcgccgtccagaagatcgaggcgggcgagacgggccggatgctggcgctg
cgcgacggcaattactgtcatgtgccgatcgacacgctgctcggcggcaccaagacggtc
gacgtcgacaggctctacgatcgcgcgcgctaccggccgaagctcacccatgtcgagggc
atgccgatgttcctctattga

DBGET integrated database retrieval system