KEGG   Sphingomonas wittichii: Swit_3015Help
Entry
Swit_3015         CDS       T00538                                 

Definition
(GenBank) pyrophosphate-dependent phosphofructokinase
  KO
K21071  ATP-dependent phosphofructokinase / diphosphate-dependent phosphofructokinase [EC:2.7.1.11 2.7.1.90]
Organism
swi  Sphingomonas wittichii
Pathway
swi00010  Glycolysis / Gluconeogenesis
swi00030  Pentose phosphate pathway
swi00051  Fructose and mannose metabolism
swi00052  Galactose metabolism
swi00680  Methane metabolism
swi01100  Metabolic pathways
swi01110  Biosynthesis of secondary metabolites
swi01120  Microbial metabolism in diverse environments
swi01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:swi00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Swit_3015
   00030 Pentose phosphate pathway
    Swit_3015
   00051 Fructose and mannose metabolism
    Swit_3015
   00052 Galactose metabolism
    Swit_3015
  Energy metabolism
   00680 Methane metabolism
    Swit_3015
Enzymes [BR:swi01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     Swit_3015
    2.7.1.90  diphosphate---fructose-6-phosphate 1-phosphotransferase
     Swit_3015
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PFK NAD_kinase
Motif
Other DBs
NCBI-ProteinID: ABQ69365
JGI: Swit3015
UniProt: A5VAP9
Position
3301038..3302138
Genome map
AA seq 366 aa AA seqDB search
MRIGVLTGGGDVPGLNPCIRSIALSALDRGWEVIGFRRGWQGFLEIDPAERESVAAHSIV
LDREAVRGIDRVGGTMLHTSRTDPRTVAGGDRTGHVLMVLDALGVDALITLGGDGTLRFS
AHLSAQGFPVVSIPKTMDNDVFGTDYCIGFSTAITRSVDAINALRTTAESHERIAIVELF
GRRSGETALLAGFLAQVDRTVIAEVPADPDVLLPLLAADRRSRPGAYAMCVISEGAKLAG
DEAEDGDRRLSATRRSETAVSRRLALLIEQRAKEGTIVQQLAYLMRSGDPDALDRMVGFA
FGGLAVQKIEAGETGRMLALRDGNYCHVPIDTLLGGTKTVDVDRLYDRARYRPKLTHVEG
MPMFLY
NT seq 1101 nt NT seq  +upstreamnt  +downstreamnt
atgcgcatcggcgtgctgaccggcggcggcgacgttccggggctcaatccctgcatccgg
tcgatcgcgctgtcggcgctcgatcgcggctgggaggtgatcggcttcaggcgcggctgg
cagggcttcctcgagatcgaccccgccgagcgggagagcgtcgccgcgcacagcatcgtg
ctcgaccgcgaggcggtgcgcgggatcgaccgggtcggcgggacgatgctccacacctcg
cgcaccgacccgcgcaccgtggccggcggcgaccgcaccggccatgtgctcatggtgctc
gacgcgctcggcgtcgacgcgctgatcacgctgggcggcgacgggacgctgcgcttctcg
gcgcatctgtcggcgcagggcttcccggtcgtctcgatccccaagacgatggacaacgac
gtgttcgggaccgactattgcatcggcttctcgaccgcgatcacccgatcggtcgacgcg
atcaacgcgctgcgcaccaccgccgagagccatgagcggatcgcgatcgtcgagctgttc
gggcggcgcagcggggagacggcgctgctcgccggcttcctggcgcaggtcgaccgcacc
gtgatcgccgaggtgccggccgatcccgacgtgctgctgccgctgctcgccgccgatcgc
cgcagccggcccggcgcctatgcgatgtgcgtgatctcggaaggggcgaagctggcgggc
gacgaggcggaggacggcgatcggcggctgtcggcgacgcggcgcagcgagacggcggtc
agccggcggctggcgctgctgatcgagcagcgggcgaaggaggggacgatcgtccagcag
ctcgcctatctgatgcgatcgggcgatcccgacgcgctcgaccggatggtcggcttcgcc
ttcggcggcctcgccgtccagaagatcgaggcgggcgagacgggccggatgctggcgctg
cgcgacggcaattactgtcatgtgccgatcgacacgctgctcggcggcaccaagacggtc
gacgtcgacaggctctacgatcgcgcgcgctaccggccgaagctcacccatgtcgagggc
atgccgatgttcctctattga

DBGET integrated database retrieval system