KEGG   Sphingomonas wittichii: Swit_3133Help
Entry
Swit_3133         CDS       T00538                                 

Gene name
gpmA
Definition
phosphoglyceromutase (EC:5.4.2.1)
Orthology
K01834  
2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
swi  Sphingomonas wittichii
Pathway
Glycolysis / Gluconeogenesis
Glycine, serine and threonine metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:swi00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Swit_3133 (gpmA)
   01230 Biosynthesis of amino acids
    Swit_3133 (gpmA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Swit_3133 (gpmA)
  Energy metabolism
   00680 Methane metabolism
    Swit_3133 (gpmA)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Swit_3133 (gpmA)
Enzymes [BR:swi01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     Swit_3133 (gpmA)
Exosome [BR:swi04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   Swit_3133 (gpmA)
  Exosomal proteins of melanoma cells
   Swit_3133 (gpmA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(3445452..3446138)
Genome map
AA seq 228 aa AA seqDB search
MPTLVLIRHGQSAWNLENRFTGWWDVNLTDQGIAEAKAAGELMAAKGLDFDQCYTSFQTR
AIKTLNIALEAMGRLWLPVEKDWRLNERHYGGLTGLNKAETAARHGDAQVKVWRRSFDIP
PPVLEPGGEFDLSKDRRYAGIAIPSTESLKDTIARVLPYWEERIAPDLKAGKRVVISAHG
NSLRALVKHLSHIPDDEITELEIPTGQPIVYELADDLTARDRYYLSER
NT seq 687 nt NT seq  +upstreamnt  +downstreamnt
atgccgacgctcgtcctgatccgccatggccagtccgcctggaatctggaaaaccgcttc
accggctggtgggatgtcaacctgaccgaccagggcatcgccgaggcgaaggcggccggc
gagctgatggccgccaagggcctcgacttcgaccagtgctacaccagcttccagacccgc
gcgatcaagacgctcaacatcgcactggaggcgatgggccggctgtggctgccggtcgag
aaggactggcgcctcaacgagcggcactatggcgggctgaccgggctcaacaaggccgag
accgcggccaggcatggcgacgcgcaggtcaaggtgtggcgccgcagcttcgacatcccg
ccgccggtgctcgaaccgggcggcgagttcgacctgtcgaaggaccgccgctacgccggc
atcgcgatccccagcaccgagagcctgaaggacacgatcgcgcgcgtcctgccctattgg
gaggagcggatcgcgcccgacctgaaggcgggcaagcgggtggtgatctccgcgcacggc
aattcgctgcgcgcgctggtcaagcatctgtcgcacattcccgacgacgagatcaccgag
ctggagattccgaccggccagccgatcgtctacgagctggccgacgacctgacggcgcgg
gaccgctattatctgtcggagcgctga

DBGET integrated database retrieval system