KEGG   Sphingomonas wittichii: Swit_3343Help
Entry
Swit_3343         CDS       T00538                                 

Definition
inositol monophosphatase
Orthology
K01082  
3'(2'), 5'-bisphosphate nucleotidase [EC:3.1.3.7]
Organism
swi  Sphingomonas wittichii
Pathway
Sulfur metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:swi00001]
 Metabolism
  Energy metabolism
   00920 Sulfur metabolism
    Swit_3343
Enzymes [BR:swi01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.7  3'(2'),5'-bisphosphate nucleotidase
     Swit_3343
Transfer RNA biogenesis [BR:swi03016]
 Eukaryotic Type
  tRNA degradation factors
   Rapid tRNA decay (RTD) pathway factors
    Swit_3343
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
3674859..3675593
Genome map
AA seq 244 aa AA seqDB search
MTDGELAAHLADFAGRLLLDVRASGMFPAKALGKAGDQTANQFLCHALRAQRPDDGLLSE
EEKDDAERLSKGRVWIVDPVDGTREYGEERADWAVHVGLAIDGVATVGAVALPGLGVVLR
SDRPQPLPPANQPLRMLVSRTRPAAEAVAVAGRLGAELLPMGSAGAKAMAVVRGEADIYL
HTGGQYEWDSCAPVAVAAAHGLFCSRVDGSPLRYNQPDVYLPDLIICRPELADAVLAAAR
AEAA
NT seq 735 nt NT seq  +upstreamnt  +downstreamnt
atgaccgacggcgaactcgccgcccatctcgccgatttcgccgggcgcctgctgctcgac
gtgcgcgcgagcgggatgttcccggccaaggcgctgggcaaggcgggcgaccagaccgcc
aaccagttcctgtgccacgcgctccgcgcgcagcgccccgacgacgggttgctgtccgag
gaggagaaggacgatgccgagcggctgtccaaggggcgcgtctggatcgtcgatccggtc
gacggcacccgcgaatatggcgaggagcgggccgactgggcggtccatgtcgggcttgcg
atcgacggcgtcgcgacggtcggcgcggtggcgctgccggggctgggcgtggtgctgcgg
tcggaccggccgcagccgctgccgcccgccaaccagccgctccgcatgctcgtcagccgc
acccggccggcggcggaggcggtcgcggtcgccggacggctgggcgccgagctgctgccg
atgggatcggccggcgccaaggcgatggcggtggtgcgcggcgaggccgacatctacctc
cacaccggcggccaatatgaatgggacagctgcgcccccgtcgcggtcgcggcggcgcac
ggcctgttctgctcgcgggtcgacggatcgccgctgcgctacaaccagcccgacgtgtac
ctgcctgacctgatcatctgccggcccgagctggccgacgcggtgctggcggcggcgcgc
gccgaagccgcctga

DBGET integrated database retrieval system