KEGG   Sphingomonas wittichii: Swit_3343Help
Entry
Swit_3343         CDS       T00538                                 

Definition
inositol monophosphatase
Orthology
K01082  
3'(2'), 5'-bisphosphate nucleotidase [EC:3.1.3.7]
Organism
swi  Sphingomonas wittichii
Pathway
Sulfur metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Class
Metabolism; Energy metabolism; Sulfur metabolism [PATH:swi00920]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
3674859..3675593
Genome map
AA seq 244 aa AA seqDB search
MTDGELAAHLADFAGRLLLDVRASGMFPAKALGKAGDQTANQFLCHALRAQRPDDGLLSE
EEKDDAERLSKGRVWIVDPVDGTREYGEERADWAVHVGLAIDGVATVGAVALPGLGVVLR
SDRPQPLPPANQPLRMLVSRTRPAAEAVAVAGRLGAELLPMGSAGAKAMAVVRGEADIYL
HTGGQYEWDSCAPVAVAAAHGLFCSRVDGSPLRYNQPDVYLPDLIICRPELADAVLAAAR
AEAA
NT seq 735 nt NT seq  +upstreamnt  +downstreamnt
atgaccgacggcgaactcgccgcccatctcgccgatttcgccgggcgcctgctgctcgac
gtgcgcgcgagcgggatgttcccggccaaggcgctgggcaaggcgggcgaccagaccgcc
aaccagttcctgtgccacgcgctccgcgcgcagcgccccgacgacgggttgctgtccgag
gaggagaaggacgatgccgagcggctgtccaaggggcgcgtctggatcgtcgatccggtc
gacggcacccgcgaatatggcgaggagcgggccgactgggcggtccatgtcgggcttgcg
atcgacggcgtcgcgacggtcggcgcggtggcgctgccggggctgggcgtggtgctgcgg
tcggaccggccgcagccgctgccgcccgccaaccagccgctccgcatgctcgtcagccgc
acccggccggcggcggaggcggtcgcggtcgccggacggctgggcgccgagctgctgccg
atgggatcggccggcgccaaggcgatggcggtggtgcgcggcgaggccgacatctacctc
cacaccggcggccaatatgaatgggacagctgcgcccccgtcgcggtcgcggcggcgcac
ggcctgttctgctcgcgggtcgacggatcgccgctgcgctacaaccagcccgacgtgtac
ctgcctgacctgatcatctgccggcccgagctggccgacgcggtgctggcggcggcgcgc
gccgaagccgcctga

DBGET integrated database retrieval system