KEGG   Sphingomonas wittichii: Swit_3620Help
Entry
Swit_3620         CDS       T00538                                 

Definition
(GenBank) succinyldiaminopimelate desuccinylase
  KO
K01439  succinyl-diaminopimelate desuccinylase [EC:3.5.1.18]
Organism
swi  Sphingomonas wittichii
Pathway
swi00300  Lysine biosynthesis
swi01100  Metabolic pathways
swi01120  Microbial metabolism in diverse environments
swi01230  Biosynthesis of amino acids
Module
swi_M00016  Lysine biosynthesis, succinyl-DAP pathway, aspartate => lysine
Brite
KEGG Orthology (KO) [BR:swi00001]
 Metabolism
  Amino acid metabolism
   00300 Lysine biosynthesis
    Swit_3620
Enzymes [BR:swi01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.18  succinyl-diaminopimelate desuccinylase
     Swit_3620
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_M20 M20_dimer
Motif
Other DBs
NCBI-ProteinID: ABQ69966
JGI: Swit3620
UniProt: A5VCF0
Position
3978475..3979608
Genome map
AA seq 377 aa AA seqDB search
MIDPLDLTQRLIACPSVTPADAGAMAVIATALESIGFTVHRFAAGEAPDGPVENLFAIRG
QGGPHFAFAGHSDVVPPGDGWTSDPFVPEIRGELLHGRGAVDMKGAIAAFIAAAARLGDH
PGTISLIITGDEEGPATFGTVALIDWMKARGLCPDLCLVGEPTSTHRLGDMVKIGRRGSV
NMWIENVGTQGHVAYPHLAANPIPALVKALDALAALHLDDGNAWFQPSNLEITTVDVGNA
ATNVIPAVARARLNIRFNDEHRGADLVELVRRTVAEHAPAATVRAVISGESFITPPGDFS
ALISAAIMKVTGLTPELSTTGGTSDARFLSKLCPVVEFGLCNATMHKLDEAVAIPDLHAL
ADIYEDIVRTVLAHPGA
NT seq 1134 nt NT seq  +upstreamnt  +downstreamnt
atgatcgaccccctcgacctgacccagcgcctgatcgcctgccccagcgtgaccccggcc
gacgccggggcgatggccgtgatcgcgacggcgctggagtcgatcggcttcaccgtccat
cgcttcgcggccggcgaggcgcccgacgggccggtcgagaatctgttcgcgatccggggg
cagggcgggccgcatttcgcctttgccgggcatagcgacgtagtgccgcccggcgacggc
tggaccagcgatcccttcgtgccggagatccgcggcgagctgctccatgggcgcggcgcc
gtcgacatgaagggagcgatcgccgccttcatcgccgccgccgcgcggctgggcgatcat
cccgggacgatcagcctgatcatcaccggcgacgaggagggacccgccaccttcggcacc
gtcgcgctgatcgactggatgaaggcgcggggcctgtgccccgacctctgcctggtcggc
gagccgacctcgacccaccggctcggcgacatggtgaagatcggccggcgcggatcggtc
aacatgtggatcgagaatgtcgggacgcagggccatgtcgcctatccgcacctcgccgcc
aacccgatccccgcgctggtcaaggcgcttgacgcgctcgcggcgctccatctcgacgac
ggcaacgcctggttccagccgtcgaacctcgagatcacgacggtcgacgtcggcaatgcc
gcgaccaacgtcatccccgccgtcgcgcgggcgcggctcaacatccgcttcaacgacgag
catcgcggcgccgacctggtcgagctggtccgccgcaccgtcgcggagcatgcgccggcg
gcgacggtgcgcgcggtgatctcgggcgagagcttcatcaccccgcccggcgacttctcg
gcgctgatctcggcggcgatcatgaaggtgaccgggctgacccccgagctgtcgaccacc
ggcggcacctccgacgcgcgcttcctgtcgaagctctgcccggtcgtcgagttcggcctg
tgcaacgcgacgatgcacaagctggacgaggcggtggcgatccccgatctccacgccctc
gccgacatctacgaggacatcgtccgcaccgtgctggcgcaccccggagcctaa

DBGET integrated database retrieval system