KEGG   Sphingomonas wittichii: Swit_3627Help
Entry
Swit_3627         CDS       T00538                                 

Definition
(GenBank) Enoyl-CoA hydratase/isomerase
  KO
K01692  enoyl-CoA hydratase [EC:4.2.1.17]
Organism
swi  Sphingomonas wittichii
Pathway
swi00071  Fatty acid degradation
swi00280  Valine, leucine and isoleucine degradation
swi00281  Geraniol degradation
swi00310  Lysine degradation
swi00360  Phenylalanine metabolism
swi00362  Benzoate degradation
swi00380  Tryptophan metabolism
swi00410  beta-Alanine metabolism
swi00627  Aminobenzoate degradation
swi00640  Propanoate metabolism
swi00650  Butanoate metabolism
swi00903  Limonene and pinene degradation
swi01100  Metabolic pathways
swi01110  Biosynthesis of secondary metabolites
swi01120  Microbial metabolism in diverse environments
swi01130  Biosynthesis of antibiotics
swi01212  Fatty acid metabolism
Module
swi_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:swi00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    Swit_3627
   00650 Butanoate metabolism
    Swit_3627
  Lipid metabolism
   00071 Fatty acid degradation
    Swit_3627
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    Swit_3627
   00310 Lysine degradation
    Swit_3627
   00360 Phenylalanine metabolism
    Swit_3627
   00380 Tryptophan metabolism
    Swit_3627
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    Swit_3627
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    Swit_3627
   00281 Geraniol degradation
    Swit_3627
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    Swit_3627
   00627 Aminobenzoate degradation
    Swit_3627
   00930 Caprolactam degradation
    Swit_3627
Enzymes [BR:swi01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     Swit_3627
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ECH_1 ECH_2
Motif
Other DBs
NCBI-ProteinID: ABQ69973
JGI: Swit3627
UniProt: A5VCF7
Position
3985723..3986367
Genome map
AA seq 214 aa AA seqDB search
MQKVGSDPSVHVVLIRAEGRGFCGGVDIKEMQAHPERIALLNRGNYLTFKAIRDCEVPVV
TAVHNFVIGGGIGVCGASDTIFAADNAYFSLPEIDRGAMGGASHLSRMLPLHKVRAAFFT
GGRIPAAEAHRLGGVEAVVPADRLVEETRAFCAVIAGKSRKALTIAKQALNGIEPRDVDR
DYRFEQGFTFEMYMHEDSQASRDAFVQTGEAAKF
NT seq 645 nt NT seq  +upstreamnt  +downstreamnt
gtgcagaaggtcggcagcgacccgtcggtccatgtcgtgctgatccgcgccgaggggcgc
ggcttctgcggcggcgtcgacatcaaggagatgcaggcgcatcccgagcggatcgcgctg
ctcaaccgcggcaactacctgaccttcaaggcgatccgcgactgcgaggtgccggtcgtc
accgcggtccacaatttcgtgatcggcgggggcatcggcgtgtgcggcgcgtccgacacg
atcttcgccgccgacaacgcctatttctcgctgcccgagatcgatcgcggcgcgatgggc
ggcgccagccacctgtcgcgcatgctgccgctccacaaggtgcgcgcggccttcttcacc
ggcggccgcatcccggcggccgaggcgcaccggctgggcggggtcgaggcggtggtgccc
gccgaccggctggtcgaggagacgcgcgccttctgcgccgtcatcgccggcaagagccgc
aaggcgctgaccatcgccaagcaggcgctgaacggcatcgagccgcgcgacgtcgatcgc
gactatcgcttcgaacagggcttcaccttcgagatgtacatgcacgaggacagccaggcg
tcgcgcgacgccttcgtccagaccggcgaggcggcgaaattctga

DBGET integrated database retrieval system