KEGG   Sphingomonas wittichii: Swit_3786Help
Entry
Swit_3786         CDS       T00538                                 

Definition
(GenBank) dihydrofolate reductase
  KO
K00287  dihydrofolate reductase [EC:1.5.1.3]
Organism
swi  Sphingomonas wittichii
Pathway
swi00670  One carbon pool by folate
swi00790  Folate biosynthesis
swi01100  Metabolic pathways
Module
swi_M00126  Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:swi00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    Swit_3786
   00670 One carbon pool by folate
    Swit_3786
Enzymes [BR:swi01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.3  dihydrofolate reductase
     Swit_3786
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DHFR_1
Motif
Other DBs
NCBI-ProteinID: ABQ70131
JGI: Swit3786
UniProt: A5VCW5
Position
complement(4155799..4156287)
Genome map
AA seq 162 aa AA seqDB search
MSRPEIVFVLARARNGVIGRDGDLPWRIPADLRHFKALTQGAPMLMGRKTFESLPGLLPG
RRHIVLTRDRDWRAEGAEVTHSVDAAVALADADRLSVVGGAEIYALLLPRADRIELTEVD
DAPEGDTVVPAFDPAVWREDAREAHPAADGKPAFAFVTLRRR
NT seq 489 nt NT seq  +upstreamnt  +downstreamnt
gtgagccggcccgaaatcgtcttcgtcctcgcccgcgcgcgcaacggggtgatcggccgc
gacggcgacctgccgtggcgcatcccggccgacctcaggcatttcaaggcgctgacccag
ggcgcgccgatgctgatggggcgcaagaccttcgagagccttcccggcctgctgcccggc
cgccgccacatcgtcctgacccgcgatcgcgactggcgcgccgagggcgccgaggtgacg
cacagcgtcgacgccgcggtcgcgctggccgatgccgaccgcctgtccgtggtcggcggc
gccgagatctacgctctgttgctgccgcgcgccgaccggatcgagctgaccgaggtcgac
gacgcgcccgagggcgacaccgtcgtccccgccttcgaccccgccgtctggcgcgaggac
gcccgcgaggcgcatccggcggcggacgggaagcccgccttcgccttcgtcacgctgcgg
cggcggtag

DBGET integrated database retrieval system