KEGG   Sphingomonas wittichii: Swit_3838Help
Entry
Swit_3838         CDS       T00538                                 

Definition
malate synthase G (EC:2.3.3.9)
Orthology
K01638  
malate synthase [EC:2.3.3.9]
Organism
swi  Sphingomonas wittichii
Pathway
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:swi00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Swit_3838
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    Swit_3838
   00630 Glyoxylate and dicarboxylate metabolism
    Swit_3838
Enzymes [BR:swi01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     Swit_3838
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
4213125..4215284
Genome map
AA seq 719 aa AA seqDB search
MECRLALSPAHPFFDSEAAMSDMIDRAGLMVADALVRFIEDRALPGTGLDAAAFWTGAAA
IFARFVPENRALLATRDDLQAKIDAWHQARASKPVDPAEYRAFLTEIGYLVPEPAPFAVG
TANVDAELATMAGPQLVVPILNARFLLNAANARWGSLYDALYGTDAIPGAAAGKGYDAAR
GAQVIAWAKGFLDQAVPLASGRWADWTGGDLALADPAQLAGRAGDNLLFRHNGLHIEVVI
DRGHAIGKDDPAGIADVILESALTTICDLEDSIAAVDAEDKVAAYANWLGLMKGDLEDTF
EKGGAMMTRRLNGDRGYTAPDGAGFTLPGRSLLFVRNVGHLMTTPAVLLADGSEAPEGIL
DGIVTSLIALHDLKGLGSHRNSARGSVYIVKPKMHGPDEAAFTNRLFDAIEDLLGMARHT
LKVGVMDEERRTSANLAACIAAVKDRIMFINTGFLDRTGDEMHTSMRAGPMIRKGDMKAS
DWIAAYEDRNVQIGLACGLSGKAQIGKGMWAAPDKMADMLAQKIGHPKTGANTAWVPSPT
AATLHATHYHAVDVFGRQAERKAEPVASIDRLLAIPVAAGKNWSPDEVRAELDNNAQGIL
GYVVRWVDQGVGCSKVPDIHDVGLMEDRATLRISSQHMANWMLHGVATAEEIDAALRRMA
AKVDAQNAGDPLYRPMAGNEDRSLAYQAARALVFEGVEQPNGYTEPLLHSFRQKVKAAA
NT seq 2160 nt NT seq  +upstreamnt  +downstreamnt
gtggaatgccggcttgcgctaagccccgcccatccatttttcgacagcgaggcggcgatg
agcgacatgatcgacagggcgggactcatggtggcggacgcgctcgtccggttcatcgag
gatcgcgcgctgcccggcaccgggctggacgccgcggccttctggaccggcgcggcggcg
atcttcgcgcgcttcgtcccggagaatcgggcgctgctcgccacccgcgacgatctccag
gcgaagatcgacgcctggcaccaggcgcgcgccagcaagccggtcgacccggccgagtat
cgggcgttcctgaccgagatcggctatctcgtccccgagcccgcgccgttcgcggtcggc
accgccaatgtcgatgccgagctggcgacgatggcgggcccgcagctcgtcgtgccgatc
ctcaacgcccgcttcctgctcaacgccgccaatgcgcgctggggcagcctctatgatgcg
ctctacggcaccgacgcgatcccgggcgcggccgccggcaagggctatgacgccgcgcgc
ggcgcgcaggtgatcgcctgggccaagggcttccttgaccaggcggtgccgctggcgtcg
gggcgctgggccgactggacgggcggcgacctcgcgctcgccgatccggcgcagcttgcc
ggccgcgcgggcgacaatctgctgttccgccacaacggcctgcatatcgaggtggtgatc
gaccgtggccatgcgatcggcaaggacgatcccgccgggatcgccgacgtcatcctcgaa
tcggcgctgacgacgatctgcgacctcgaggattcgatcgcggcggtcgacgccgaggac
aaggttgccgcctatgccaactggctcggcctgatgaagggcgacctggaggacacgttc
gagaagggcggggcgatgatgacccgccgcctcaacggggaccgcggctacaccgcgccc
gacggcgccggcttcaccctgccgggccgcagcctgttgttcgtccgcaatgtcggccat
ctgatgacgactccggcggtgctgctcgctgacggatcggaagcgccggagggcatcctc
gacggcatcgtcaccagcctgatcgcgctgcatgacctgaagggcctcggcagccaccgc
aacagcgccaggggctcggtctacatcgtcaagccgaagatgcacgggccggacgaggcc
gctttcaccaaccgcctgttcgacgcgatcgaggacctgctcggcatggcgcgccacacg
ctcaaggtcggcgtgatggacgaggagcgccgcacctcggccaacctcgccgcctgcatc
gcggcggtgaaggaccggatcatgttcatcaacaccggcttcctcgatcgcaccggcgac
gagatgcacacctcgatgcgggccggtccgatgatccgcaagggcgacatgaaggccagc
gactggatcgccgcctatgaggaccgcaacgtccagatcggcctcgcctgcggactgtcg
ggcaaggcgcagatcggcaagggcatgtgggccgcgcccgacaagatggccgacatgctc
gcccagaagatcggccatccgaagaccggcgccaacaccgcctgggtgccgtccccgacc
gccgcgacgctgcacgcgacccattatcacgcggtcgacgtgttcggccggcaggcggaa
cgcaaggccgagccggtcgcgagcatcgaccggctgctggccatcccggtcgcggcgggc
aagaactggagccccgacgaggtccgcgccgagctcgacaacaacgcccagggcatcctc
ggctatgtcgtccgctgggtcgaccagggcgtcggctgctcgaaggtgcccgatatccac
gacgtcggcctgatggaggaccgcgctacgctgcgcatctcgtcgcagcacatggcgaac
tggatgctgcacggcgtcgccaccgccgaggagatcgacgccgcgctcaggcgcatggcc
gccaaggtcgacgcgcagaacgccggcgatccgctctatcggccgatggccgggaacgag
gaccgcagcctcgcctatcaggccgcccgcgcactggtgttcgagggcgtcgagcagccc
aacggctataccgagccgctgctccacagcttccggcaaaaggtgaaggcggcggcctga

DBGET integrated database retrieval system