KEGG   Sphingomonas wittichii: Swit_3896Help
Entry
Swit_3896         CDS       T00538                                 

Definition
gamma-glutamyl kinase (EC:2.7.2.11)
Orthology
K00931  
glutamate 5-kinase [EC:2.7.2.11]
Organism
swi  Sphingomonas wittichii
Pathway
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of amino acids
Module
Proline biosynthesis, glutamate => proline
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:swi01230]
Metabolism; Amino acid metabolism; Arginine and proline metabolism [PATH:swi00330]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
4281063..4282205
Genome map
AA seq 380 aa AA seqDB search
MVADLTPAASRFTPAACPRLVVKIGSALLVDPDGRVRRDWLQGVVADIAERHRAGQRIAV
VSSGAIALGARRLALPKGGRASLEDAQAAAATGQIALSHCWAELLHAEGLTAAQILVTLD
DLEDRRRYLNAASTLHRLLGLGVVPVINENDSVATAEIRFGDNDRLAARIGQAADAGGVI
LLSDIDGLYTANPHRDPTARLVPEVARIDARIRAMADADSASGMGSGGMISKLEAARIAQ
RSGAHLAIITGKRDHPLAAFDADHRGTVFLGEKIGTARKAWLAGRLTAKGRIVVDAGAVG
ALAQGRSLLAAGAVRVEGRFARGDVVDIVAPDGQAIARGLIEYDAVDAAKIVGRRSNAHE
QILGYAPRSALVHRDHMVLL
NT seq 1143 nt NT seq  +upstreamnt  +downstreamnt
atggtcgccgatctgaccccggccgcttcccgcttcacccccgctgcctgtccccgcctg
gtcgtcaagatcgggtcggcgctgctcgtcgatcccgacggcagggtccggcgcgactgg
ctgcagggcgtcgtcgccgacatcgccgagcggcaccgcgcggggcagcggatcgcggtc
gtctcctcgggcgcgatcgcgctcggcgcgcggcggctggcgctgcccaagggggggcgc
gccagcctggaggatgcacaggccgccgccgcgaccgggcagatcgcgctgtcgcactgc
tgggccgagctgctccatgccgaagggctcaccgccgcgcagatcctcgtcacgctcgac
gacctcgaggatcgccgccgctacctgaacgcggcgtcgacactccaccggctgctcggc
ctcggcgtggtgccggtgatcaacgagaatgattcggtcgccacggcggagatccgcttc
ggcgacaacgaccggctcgccgcgcggatcggccaggccgccgacgcgggcggggtgatc
ctgctgtccgacatcgacgggctctacaccgccaatccgcatcgcgacccgaccgcgcgg
ctggtgcccgaggtggcgcggatcgacgcgcgcatccgcgcgatggccgatgccgattcg
gcctccggcatgggatcgggcgggatgatctcgaagctggaggcggcgcgcatcgcgcag
cgctccggcgcgcatctcgcgatcatcaccggcaagcgcgatcacccgctggcggcgttc
gacgccgaccatcgcggcaccgtcttcctcggggagaagatcggcaccgcgcgcaaggcc
tggctcgccggacggctgaccgccaagggccggatcgtcgtcgatgccggcgcggtcggc
gcgctggcgcaggggcgcagcctgctcgccgccggggcggtccgggtcgaggggcgcttc
gcgcgcggcgacgtggtcgacatcgtcgcgccggacggccaagcgatcgcgcgcggcctg
atcgaatatgacgcggtcgacgccgccaagatcgtcggccggcgcagcaacgcccacgaa
cagatcctcggctatgcgccgcgttcggcgctggtccaccgcgaccatatggtcctgctg
tga

DBGET integrated database retrieval system