KEGG   Sphingomonas wittichii: Swit_4077Help
Entry
Swit_4077         CDS       T00538                                 

Definition
glutathione peroxidase (EC:1.11.1.9)
Orthology
K00432  
glutathione peroxidase [EC:1.11.1.9]
Organism
swi  Sphingomonas wittichii
Pathway
Glutathione metabolism
Arachidonic acid metabolism
Class
Metabolism; Lipid metabolism; Arachidonic acid metabolism [PATH:swi00590]
Metabolism; Metabolism of other amino acids; Glutathione metabolism [PATH:swi00480]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(4475562..4476050)
Genome map
AA seq 162 aa AA seqDB search
MTTVYDFSARAIDGSEVPLDRWRGKVLLIVNTASQCGFTPQYAGLEMLHEQLSDRGLVVL
GFPCNQFGGQEPGSEAEIDAFCRTSYDVRFPMFAKVEVNGPAAHPLYGWLKSNARGILGT
EGIKWNFTKFLIDRSGQVFSRYAPTTKPEAIRGEIEELLEDA
NT seq 489 nt NT seq  +upstreamnt  +downstreamnt
atgacgaccgtctatgacttctcggcccgcgcgatcgacggcagcgaggtcccgctcgac
cgctggcgcggcaaggtgctgctgatcgtcaacaccgccagccagtgcggcttcaccccg
caatatgcggggctcgagatgctgcacgagcaattgtccgaccgcgggctggtggtgctc
ggcttcccctgcaaccagttcggcgggcaggagccgggcagcgaggcggagatcgacgcc
ttctgccgcaccagctacgacgtccgcttcccgatgttcgccaaggtcgaggtcaacggc
ccggccgcccacccgctctacggctggctgaagagcaacgcgcgcggcatcctcggcacc
gagggcatcaagtggaacttcaccaaattcctgatcgaccgctccggccaggtgttcagc
cgctacgccccgaccaccaagcccgaggcgatccgcggcgagatcgaggaactgctcgaa
gacgcctga

DBGET integrated database retrieval system