KEGG   Sphingomonas wittichii: Swit_4548Help
Entry
Swit_4548         CDS       T00538                                 

Definition
asparagine synthase
Orthology
K01953  
asparagine synthase (glutamine-hydrolysing) [EC:6.3.5.4]
Organism
swi  Sphingomonas wittichii
Pathway
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Amino acid metabolism; Alanine, aspartate and glutamate metabolism [PATH:swi00250]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
5001085..5003340
Genome map
AA seq 751 aa AA seqDB search
MPRGRRGRPHRPRPVRLPRRARPYREGGARAPVRRACASPHMVRQAWRADRAGGDLPHPG
ARPPLSPRPRRPSDPHPHRRPPARRRADRRACLAGRRRRRADRRAGRAAFPLHAARRSPG
RPAMSGFAALFRRDGAPMAEALPDRAEAALRARGPCHWRRGRSWAMAASAPLAGSADAMA
LVAADARLDNRRELIAALRLHPGSSDAEVILAAYRRWEGDCVRRLAGDFAFVIRDDRRGA
IFCARDHFGVRPFYYALDDKLFAAAGLTRFLTALPAIGDAIDEQGLADLLAGGYADGAIT
RHRGVRRLPPGHSLTLTEAGGRIARYWHPRDVPVEERADAAEGFRALFAEAVVRRRARGD
GVGVMLSGGLDSSAIAVQATQGFAATGRRMPSLSMMLDDTPGWNERPFIEAVHDRGGFDP
RFIDAADHDPVAELPALLDEQEGPFVAYNASLSRRLYRRARAAGLTRLLDGHGGDEVVSH
GLGRLNELAARGEWRRLWEESAGIAGIYGVGRWSILSPYLSHNRYVRLARGRWDRIRARL
GRADPGEIAGASLVEPGLAARVGLAERHADRSIKRSARHSERDVHIELLTAPQQGYGFEV
LDRMGAAAGVAGLYPFYDLRLVEYCLSLPSHHKLNHGLPRHVLRQAMAGLLPDPVRLRPD
KYDFAPALADALLRRRVALADLVGRDRAGIGRFVDMDAARTALGRLLDRGRAVDGASLFA
AWRVLMLAVWLDRRERVSGGWSEIVEREAAA
NT seq 2256 nt NT seq  +upstreamnt  +downstreamnt
atgcctcgcggtcgtcgcggccgtccgcatcggcctcgccctgttcggctaccgcgtcgt
gctcgaccatatcgcgaaggcggcgcccgcgcgcccgtccggcgcgcatgcgcatctcca
catatggtgcgtcaagcatggcgcgcggatcgtgccgggggcgacctgcctcacccaggc
gctcgccctccattatctccgcgcccgcgccggccatccgacccgcatccgcatcggcgt
ccgccggcgcgacgacgggcggatcgccgcgcatgcctggctggtcgacggcgacgccgt
gctgatcggcgggcaggacgagcagctttcccgcttcacgccgctcgtcgatctccaggc
cggcctgcgatgagcggcttcgcggccctgttccgccgcgacggcgcgcccatggccgaa
gcccttcccgatcgtgccgaggcggcgctgcgcgcgcgcggaccctgccactggcggcgg
gggcggtcctgggcgatggccgcgtccgcgccgctcgccggctcggccgatgcgatggcg
ctcgtcgcggccgacgcgcggctcgacaatcgccgcgagctgatcgcggcgttgcggctc
catcccggctcgtccgacgccgaggtcatccttgccgcctatcggcgctgggagggcgat
tgcgtccgcaggctggccggcgatttcgccttcgtcatccgcgacgaccggcgcggggcg
attttctgcgcgcgcgaccatttcggcgtccggcccttctattatgcgctcgacgacaag
ttgttcgccgccgccggcctcacccgtttcctgaccgcgcttcccgcgatcggcgacgcg
atcgacgagcagggcctcgccgatctgctggcgggcggctatgccgacggggcgatcacg
cggcatcgcggcgtccgccgcctgccgcccggccacagcctgacgctgaccgaggcaggg
gggcggatcgcgcgctactggcatccgcgggacgtgccggtcgaggagcgcgccgacgcg
gccgagggatttcgcgcgctgttcgccgaggcggtcgtccgccgccgcgcgcgcggcgac
ggcgtcggggtgatgctgagcggcgggctcgattcctcggcgatcgcggtgcaggcgacg
cagggcttcgccgccaccggccggcggatgccgagcctgtcgatgatgctggacgacacg
cccggctggaacgagcggccgttcatcgaggcggtgcacgaccggggcggcttcgacccg
cgcttcatcgacgccgccgaccatgacccggtcgccgagctgcccgcgctgctcgacgag
caggagggccccttcgtcgcctataatgccagcctgtcgcgccgcctctaccgccgggcg
cgggcggcgggcctcactcgcctgctcgacggccatggcggcgacgaggtggtgtcgcac
gggctgggccgcctcaacgagctggccgcccgaggcgagtggcgtcgactctgggaggag
agcgccggcatcgccggcatctatggcgtcggccgttggtcgatcctgtcgccctatctg
agccataaccgctatgtccgcctcgcgcgcgggcgctgggatcgaatccgagcgcggctg
gggcgggccgatccgggcgagatcgccggagcgtcgctggtcgaacccggtctcgccgcg
cgcgtcggcctcgccgaacgccatgccgatcgctcgatcaagcgatcggcgcgccatagc
gagcgcgacgtccatatcgagctgctgaccgcgccgcagcagggctatggcttcgaggtg
ctcgaccggatgggcgcggcggccggggtcgccggcctctaccccttctacgacctgcga
ctggtcgaatattgcctgtcgctgccatcgcatcacaagctgaaccacggcctgccccgc
catgtgctgcggcaggcgatggccgggctgctgcccgatccggtgcggctgcgacccgac
aaatatgatttcgcacccgcgctcgccgatgcgctgctgcgccgtcgcgtggccctcgcc
gatctggtcggccgcgaccgggcggggatcggccgcttcgtcgacatggatgcggcgcgg
acggcgctcggccggctgctcgaccggggccgcgcggtcgatggcgcgtcgctgttcgcg
gcctggcgggtgctgatgctggcggtctggctcgaccgccgcgaacgggtttcggggggc
tggtccgagatcgtcgaaagggaggccgccgcatga

DBGET integrated database retrieval system