KEGG   Sphingomonas wittichii: Swit_4577Help
Entry
Swit_4577         CDS       T00538                                 

Definition
dihydropteroate synthase (EC:2.5.1.15)
Orthology
K00796  
dihydropteroate synthase [EC:2.5.1.15]
Organism
swi  Sphingomonas wittichii
Pathway
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:swi00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    Swit_4577
Enzymes [BR:swi01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.15  dihydropteroate synthase
     Swit_4577
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
5034704..5035819
Genome map
AA seq 371 aa AA seqDB search
MSISRYARLYFRPTAFVASPFGHAEGTVARLAGGLVWFSAYEVIAVDGGQRVATRHVPVA
AIDAFVDSLSGEQAEDARRTIARIVAPRPPVELGERVLRFDQPQVMLILNITPDSFSDGG
NHLDDPAAATDGAFAAVEAGAAIVDVGGESTRPGAQPVWEGDEIARIEPVVRRLAAGGAI
VSIDTRKAAVMAAALAAGAAIVNDVSALVYDPKAATLLARHDCPVVLMHHQGDPETMQRE
PRYGDALIEVYDWLAERIAFAEAAGIARGRIIVDPGIGFGKNLRHNLQILNGLALFHGLG
CPLLLGASRKRIIGALSNEAPVDQRLGGSVALALHGAQMGAQILRVHDVPETVQAIRVWR
GMRDEALTPSF
NT seq 1116 nt NT seq  +upstreamnt  +downstreamnt
atgagcatctcccgctacgcccggctctatttccggccgaccgccttcgtcgcctcgccc
ttcggccatgccgagggcacggtggcccggctggcgggcggactggtctggttctccgcc
tatgaggtgatcgccgtcgatggggggcagcgggtcgcgacccgccatgtgcccgtcgcg
gcgatcgatgctttcgtcgacagcctgtccggcgagcaggcggaggacgcgcggcggacg
atcgcgcggatcgtggcgccgcgcccgccggtcgaactgggcgagcgcgtcctgcgcttc
gatcagccgcaggtcatgctgatcctcaacatcacgcccgacagcttctcggacggcggc
aaccatctcgacgaccccgccgccgcgaccgatggcgccttcgcggcggtcgaggcgggg
gcggcgatcgtcgatgtcggcggggagtcgacccggccgggcgcgcagccggtctgggag
ggcgacgagatcgcccggatcgagccggtggtgcggcggctggcggcgggcggggcgatc
gtctcgatcgacacgcgcaaggcggcggtgatggcggcggcgctggcggcgggggccgcg
atcgtcaacgacgtctccgcgctcgtttatgacccgaaggcggctacgctgctggcgcgg
cacgattgcccggtcgtgctgatgcaccatcagggcgatcccgagacgatgcagcgcgag
ccgcgctacggcgacgcgctgatcgaggtctatgactggctggcggagcggatcgccttc
gccgaggcggcgggcatcgcgcgcggccggatcatcgtcgatcccggcatcggcttcggc
aagaacctccgccacaatctccagatattgaacgggctggcgctgttccacggcctcggc
tgtccgctgctgctgggcgccagccgcaagcggatcatcggcgcgctgtcgaacgaggcg
ccggtcgaccagcgcctcggcggctcggtcgcgctggcgcttcacggcgcccagatgggc
gcgcagatattgcgggtccacgacgtgcccgagacggtgcaggcgatccgggtgtggcgc
gggatgcgcgacgaggcgttgacgccttccttttga

DBGET integrated database retrieval system