KEGG   Sphingomonas wittichii: Swit_4687Help
Entry
Swit_4687         CDS       T00538                                 

Definition
class I cytochrome c
Orthology
K08738  
cytochrome c
Organism
swi  Sphingomonas wittichii
Pathway
Sulfur metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Two-component system
Brite
KEGG Orthology (KO) [BR:swi00001]
 Metabolism
  Energy metabolism
   00920 Sulfur metabolism
    Swit_4687
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    Swit_4687
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(5155669..5156298)
Genome map
AA seq 209 aa AA seqDB search
MDDRANTIAGWALAGGIAALGLSILSGEYFKAERPEKMGYVVEGVEEEGDAGAAAAADKP
IAFYLASADPAKGADVFKKCAACHNAANGGPNALGPNLWGVLGEGVGQGAHGFAFSDALK
SKGGTWDWQNLSDWLKSPKAFAPGTKMTFAGLSKPEDRANVIAYLNQQSNSPRPMPAVPA
EAAAPAAEGGAADNAAAPAEGGNEAAPAK
NT seq 630 nt NT seq  +upstreamnt  +downstreamnt
atggacgatcgcgcgaacactattgccggctgggcgctggctggcggcattgccgcattg
ggcctttcgatcctcagcggcgaatatttcaaggccgagcgtccggaaaagatgggctat
gtggtcgagggcgtcgaggaagaaggcgacgccggcgctgccgccgcggccgacaagccg
atcgccttctacctcgccagcgccgatccggcgaagggcgccgacgtcttcaagaagtgc
gccgcctgccacaatgccgcgaacggcggcccgaatgcgctcggcccgaatctgtggggc
gtccttggcgagggcgtcggccagggcgcgcacggcttcgccttctccgatgcgctcaag
tcgaagggcggcacctgggactggcagaatctcagcgactggctgaagagcccgaaggcg
ttcgcgccgggcaccaagatgaccttcgcgggcctctccaagcccgaggatcgcgccaac
gtcatcgcctatctcaaccagcagagcaattcgccgcggccgatgccggcggtgcccgcc
gaagcggcggccccggcggccgaaggcggcgcggccgacaatgccgcggccccggccgag
ggcggcaacgaggcggcgcccgccaagtaa

DBGET integrated database retrieval system