KEGG   Sphingomonas wittichii: Swit_4687Help
Entry
Swit_4687         CDS       T00538                                 

Definition
(GenBank) cytochrome c, class I
  KO
K08738  cytochrome c
Organism
swi  Sphingomonas wittichii
Pathway
swi02020  Two-component system
Brite
KEGG Orthology (KO) [BR:swi00001]
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    Swit_4687
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Cytochrom_C Cytochrome_CBB3
Motif
Other DBs
NCBI-ProteinID: ABQ71024
JGI: Swit4687
UniProt: A5VFF8
Position
complement(5155669..5156298)
Genome map
AA seq 209 aa AA seqDB search
MDDRANTIAGWALAGGIAALGLSILSGEYFKAERPEKMGYVVEGVEEEGDAGAAAAADKP
IAFYLASADPAKGADVFKKCAACHNAANGGPNALGPNLWGVLGEGVGQGAHGFAFSDALK
SKGGTWDWQNLSDWLKSPKAFAPGTKMTFAGLSKPEDRANVIAYLNQQSNSPRPMPAVPA
EAAAPAAEGGAADNAAAPAEGGNEAAPAK
NT seq 630 nt NT seq  +upstreamnt  +downstreamnt
atggacgatcgcgcgaacactattgccggctgggcgctggctggcggcattgccgcattg
ggcctttcgatcctcagcggcgaatatttcaaggccgagcgtccggaaaagatgggctat
gtggtcgagggcgtcgaggaagaaggcgacgccggcgctgccgccgcggccgacaagccg
atcgccttctacctcgccagcgccgatccggcgaagggcgccgacgtcttcaagaagtgc
gccgcctgccacaatgccgcgaacggcggcccgaatgcgctcggcccgaatctgtggggc
gtccttggcgagggcgtcggccagggcgcgcacggcttcgccttctccgatgcgctcaag
tcgaagggcggcacctgggactggcagaatctcagcgactggctgaagagcccgaaggcg
ttcgcgccgggcaccaagatgaccttcgcgggcctctccaagcccgaggatcgcgccaac
gtcatcgcctatctcaaccagcagagcaattcgccgcggccgatgccggcggtgcccgcc
gaagcggcggccccggcggccgaaggcggcgcggccgacaatgccgcggccccggccgag
ggcggcaacgaggcggcgcccgccaagtaa

DBGET integrated database retrieval system