KEGG   Sphingomonas wittichii: Swit_5355Help
Entry
Swit_5355         CDS       T00538                                 

Definition
CheB methylesterase (EC:3.1.1.61)
Orthology
K03412  
two-component system, chemotaxis family, response regulator CheB [EC:3.1.1.61]
Organism
swi  Sphingomonas wittichii
Pathway
Two-component system
Bacterial chemotaxis
Brite
KEGG Orthology (KO) [BR:swi00001]
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    Swit_5355
 Cellular Processes
  Cell motility
   02030 Bacterial chemotaxis
    Swit_5355
Enzymes [BR:swi01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.61  protein-glutamate methylesterase
     Swit_5355
Two-component system [BR:swi02022]
 CheA family
  CheA-CheYBV
   Swit_5355
Bacterial motility proteins [BR:swi02035]
 Flagellar system
  Chemotaxis proteins
   Two component system proteins
    Swit_5355
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
pSWIT01:265012..265587
Genome map
AA seq 191 aa AA seqDB search
MSRDPIRAVVIGASAGAVQVLLEILPALPPTFPVPIFIVVHIPPDRTNALTTLFADRCGL
TVKEAEDKETPVPGTVYFAPADYHLLIEQDGRVALAMDEPVHHSRPAIDVLFETAADAFG
PDLVAIVLTGANEDGAAGLRAVGEAGGLTLVEDPTSASSSTMPTAALAAWPQARAQDVPG
IIAYLQTLVAP
NT seq 576 nt NT seq  +upstreamnt  +downstreamnt
atgagccgggatccgatcagggcggtcgtcatcggcgcctcggccggcgcggtgcaggtc
ctgctggaaatcctgcccgcgctcccgccaacgttccccgtcccgatcttcatcgtcgtg
catatcccgccagatcgcaccaacgccctcaccacccttttcgcggatcgctgcgggctg
acagtcaaggaggcggaagacaaggagactcctgtcccgggcacggtctatttcgcgccg
gccgattatcatctgctgatcgaacaggacgggcgcgtggccctggcgatggacgagccg
gttcatcattcgcggccagcgatcgacgtccttttcgagaccgcggccgacgcgttcgga
cccgatctcgtcgccatcgtgctgaccggtgcgaacgaggatggtgccgcgggcctgcga
gccgtcggggaggcgggcgggctgacccttgtcgaagacccgacgagtgcctcgagttct
accatgccgaccgccgcgcttgcggcgtggccccaagcgcgggctcaggatgtgcccggc
atcatcgcttaccttcagaccctggtggctccatga

DBGET integrated database retrieval system