KEGG   Sphingomonas wittichii: Swit_5369Help
Entry
Swit_5369         CDS       T00538                                 

Definition
(RefSeq) hypothetical protein
  KO
K03981  
thiol:disulfide interchange protein DsbC [EC:5.3.4.1]
Organism
swi  Sphingomonas wittichii
Brite
Enzymes [BR:swi01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     Swit_5369
Secretion system [BR:swi02044]
 Type IV secretion system
  Conjugal transfer pilus assembly protein
   Swit_5369
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
pSWIT01:275546..276427
Genome map
AA seq 293 aa AA seqDB search
MSVTDRLRAAAGRTPWSFGLIALPVVGLGAAAIAAAAVPTEDSQVAGLLKARLPKTEISA
VNCAKVAGLCEVTAGANLFYVDRGARYLVIGRVYDMETRQDVTAARLLEMNPDMLVGGAA
KANATAALGGEADASPVAPTAGARRVSVPVRPATLSLAGLPRDGAIVWGNKASSQSVTVF
TDFRCGYCRALTSVLRSMDVKVIERPISVLGSRDLADRVYCAKNREEALHAAYSGAPFES
GGKCDTRGLDANEQFARSHGLSGTPVIVRSDGAMLEGYRPKDVLEAWLKGAKS
NT seq 882 nt NT seq  +upstreamnt  +downstreamnt
atgtccgtaactgatcgccttcgcgccgctgctgggcgcacgccctggagctttggcctc
attgccctgccggtggtgggactgggcgctgcagccatcgctgccgccgccgtgccgacc
gaagacagccaggtcgccggcctgctcaaggcccggctacccaagaccgagatcagcgcg
gtcaactgcgccaaggtcgcagggctgtgcgaagtgacggccggcgccaatctcttctat
gtcgatcgcggcgcccgctatctggtcatcggccgggtctacgacatggaaacgcggcag
gacgtgacggccgcacgcctcctggagatgaaccccgacatgctggtcggcggcgcggcc
aaggccaatgcgacggccgcgctcggcggcgaggcggacgcttctcccgtcgcaccgaca
gccggcgcgcgccgtgtctccgtgccagtgcgcccggccacgctgtcgctcgctgggctg
ccgcgcgacggagcgatcgtctggggcaacaaggcatcgagccagtcggtcacggtcttt
accgattttcgctgcggctactgccgcgcgcttaccagcgtgctgcgcagcatggacgtc
aaggtcatcgaacggcccatttcggtcctgggcagccgggatctggccgaccgcgtctat
tgcgccaagaaccgggaagaggcgcttcacgccgcctattccggtgcgccgttcgaaagc
ggcggcaaatgtgacacgcgcggtctcgacgccaacgagcaatttgcccgtagccatggc
ctgagcggaacccccgtgatcgttcgcagcgacggcgccatgcttgagggctaccggccc
aaggatgtgctggaagcatggctgaagggagccaagtcgtga

DBGET integrated database retrieval system