KEGG   Sphingomonas wittichii: Swit_5369Help
Entry
Swit_5369         CDS       T00538                                 

Definition
hypothetical protein
Orthology
K03981  
thiol:disulfide interchange protein DsbC [EC:5.3.4.1]
Organism
swi  Sphingomonas wittichii
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
pSWIT01:275546..276427
Genome map
AA seq 293 aa AA seqDB search
MSVTDRLRAAAGRTPWSFGLIALPVVGLGAAAIAAAAVPTEDSQVAGLLKARLPKTEISA
VNCAKVAGLCEVTAGANLFYVDRGARYLVIGRVYDMETRQDVTAARLLEMNPDMLVGGAA
KANATAALGGEADASPVAPTAGARRVSVPVRPATLSLAGLPRDGAIVWGNKASSQSVTVF
TDFRCGYCRALTSVLRSMDVKVIERPISVLGSRDLADRVYCAKNREEALHAAYSGAPFES
GGKCDTRGLDANEQFARSHGLSGTPVIVRSDGAMLEGYRPKDVLEAWLKGAKS
NT seq 882 nt NT seq  +upstreamnt  +downstreamnt
atgtccgtaactgatcgccttcgcgccgctgctgggcgcacgccctggagctttggcctc
attgccctgccggtggtgggactgggcgctgcagccatcgctgccgccgccgtgccgacc
gaagacagccaggtcgccggcctgctcaaggcccggctacccaagaccgagatcagcgcg
gtcaactgcgccaaggtcgcagggctgtgcgaagtgacggccggcgccaatctcttctat
gtcgatcgcggcgcccgctatctggtcatcggccgggtctacgacatggaaacgcggcag
gacgtgacggccgcacgcctcctggagatgaaccccgacatgctggtcggcggcgcggcc
aaggccaatgcgacggccgcgctcggcggcgaggcggacgcttctcccgtcgcaccgaca
gccggcgcgcgccgtgtctccgtgccagtgcgcccggccacgctgtcgctcgctgggctg
ccgcgcgacggagcgatcgtctggggcaacaaggcatcgagccagtcggtcacggtcttt
accgattttcgctgcggctactgccgcgcgcttaccagcgtgctgcgcagcatggacgtc
aaggtcatcgaacggcccatttcggtcctgggcagccgggatctggccgaccgcgtctat
tgcgccaagaaccgggaagaggcgcttcacgccgcctattccggtgcgccgttcgaaagc
ggcggcaaatgtgacacgcgcggtctcgacgccaacgagcaatttgcccgtagccatggc
ctgagcggaacccccgtgatcgttcgcagcgacggcgccatgcttgagggctaccggccc
aaggatgtgctggaagcatggctgaagggagccaagtcgtga

DBGET integrated database retrieval system