KEGG   Syntrophomonas wolfei: Swol_0099Help
Entry
Swol_0099         CDS       T00396                                 

Definition
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase (EC:2.7.6.3)
Orthology
K00950  
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase [EC:2.7.6.3]
Organism
swo  Syntrophomonas wolfei
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:swo00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    Swol_0099
Enzymes [BR:swo01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.6  Diphosphotransferases
    2.7.6.3  2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase
     Swol_0099
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
107909..108403
Genome map
AA seq 164 aa AA seqDB search
MKKRVYIGLGSNCGLKQENLAVARNKITELEGTRIVKSSSLYLTAPWGRTEQEDFINQVI
EIKTALEPLALLQDLQEIEIKMGRQRQEKWGPRIIDLDILLFGDEVLDFPELKVPHPLMR
QRLFVLVPLQEVNAELIFPDDGAKIKEVLISVLAREGNKKIKRV
NT seq 495 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaaagagtttacataggactaggctcaaattgcggccttaaacaagagaatttg
gcggttgccaggaataagattactgaattggaaggaaccagaattgttaagagttcctcc
ctttatttaaccgctccctggggccgtaccgagcaggaagattttataaatcaagtaata
gaaatcaaaacggctttggagccgttggccttgttgcaggatttgcaagaaattgaaatt
aaaatgggccgccagcgtcaggaaaaatggggccctcggataatagacctggatatcctt
ttatttggagatgaggtgctggattttccggaattgaaagtcccacacccactcatgcgg
cagcgtttgtttgtactggttcccttgcaggaagtaaatgcagaactcatctttcctgat
gatggagccaaaatcaaggaggtgttgattagcgttttagcccgggaaggaaacaagaaa
atcaagagagtataa

DBGET integrated database retrieval system