KEGG   Syntrophomonas wolfei: Swol_0259Help
Entry
Swol_0259         CDS       T00396                                 

Definition
(GenBank) glucokinase / transcriptional regulator
  KO
K00845  glucokinase [EC:2.7.1.2]
Organism
swo  Syntrophomonas wolfei
Pathway
swo00010  Glycolysis / Gluconeogenesis
swo00052  Galactose metabolism
swo00500  Starch and sucrose metabolism
swo00520  Amino sugar and nucleotide sugar metabolism
swo00521  Streptomycin biosynthesis
swo01100  Metabolic pathways
swo01110  Biosynthesis of secondary metabolites
swo01120  Microbial metabolism in diverse environments
swo01130  Biosynthesis of antibiotics
swo01200  Carbon metabolism
Module
swo_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:swo00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Swol_0259
   00052 Galactose metabolism
    Swol_0259
   00500 Starch and sucrose metabolism
    Swol_0259
   00520 Amino sugar and nucleotide sugar metabolism
    Swol_0259
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    Swol_0259
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    Swol_0259
Enzymes [BR:swo01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     Swol_0259
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ROK
Motif
Other DBs
NCBI-ProteinID: ABI67608
JGI: Swol0259
UniProt: Q0B096
Position
301619..302629
Genome map
AA seq 336 aa AA seqDB search
MVVCVDLGGSKVLMAVAMAEGQFLRRLKFPTQSEKGPEDILDRIAAGVQEMLKAGAETAD
RIVGIGVATPGPLSFPDTVVWDSPNLGWNRVNIKEEMKARLGWEPLVEKDTNMAVLGEYY
FGQMQRCQNLLYITVSTGIGGGIMLGGQLYRGQNGGAGEIGHMVVASGGRICGCGRQGCL
EAQASGTAIAQMAKELGQEGKGQGMFSGLGTVGAKEVGEAARRGDREARTIVAQVVDYLG
IALGNLVNIFNPEKIVLGGAVSLGWEDLLLEPLRERVKAEVFPLNARDLQIEVTRLGEDV
VLYGCIAEVGRRKTEGGKRKAEDGRSCIRVDSTNFF
NT seq 1011 nt NT seq  +upstreamnt  +downstreamnt
ttggttgtatgtgtggatctgggaggcagcaaagtgctgatggctgttgctatggctgag
ggacagttcttgcgccgcctgaagtttcccacccagagcgaaaaagggccggaagatatt
ctggatcgtatagcagccggggttcaggaaatgttaaaagcaggggcggaaacagctgat
aggattgtgggtataggagtagctactcctgggccgctttcgtttccggacacggtggtt
tgggattcgcccaacctgggatggaaccgggtgaacattaaagaggaaatgaaagctcgg
ctgggttgggagccgctggtggagaaagataccaatatggctgttttgggagaatattat
tttggccagatgcagcgctgccagaacctgctctatattacggttagtaccggaatcggt
ggaggaataatgttaggaggccagctctataggggtcaaaatgggggagccggagaaatc
gggcatatggtagtggcttccggggggagaatctgcggctgcggaaggcagggctgcttg
gaagctcaggcttcaggaaccgccatagcgcagatggcaaaggagcttgggcaggaggga
aaaggacagggaatgttttccggcctgggcacggtcggggccaaagaggtgggagaagcc
gctcgccgaggagatagggaagcccggaccattgtagctcaggtggtagattatctggga
atagccctgggcaacctggttaatatatttaatcccgagaaaatagtattaggcggggcc
gtaagcctgggttgggaagaccttcttctggagccgcttcgggaaagagttaaagcggaa
gttttcccgcttaatgcccgcgatctgcagatagaggttacccgcctgggggaggatgta
gtactttatggttgcatagcagaagtcggaaggcggaagacggaaggcggaaaacggaag
gcggaggacggaaggagttgtataagggtcgactccaccaacttcttttga

DBGET integrated database retrieval system