KEGG   Syntrophomonas wolfei: Swol_0278Help
Entry
Swol_0278         CDS       T00396                                 

Definition
esterase/lipase
Orthology
K03928  
carboxylesterase [EC:3.1.1.1]
Organism
swo  Syntrophomonas wolfei
Brite
Enzymes [BR:swo01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.1  carboxylesterase
     Swol_0278
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
320923..321681
Genome map
AA seq 252 aa AA seqDB search
MSGTHIHRQAQPFFLKGDSRVALLFIHGFTASPSELYPVAELLHQLCACSISGLLLPGHG
SRPEDLNLCRWQDWFAAVKTALLNLQEEYAEVFVVGLSMGGLLALYSGLHVPGVCGVSSI
NAPVFQRSTLTTALAPLIKIFRPYWPKQEQGRQRQLEAEGRFAYDCFPLHAFQSMMELRN
QVVRELGDLKVPVLIMQSQNDEVVKSESGRYLAAQLRHREARLVELENSEHVATMGPEKK
KIAHELAEFITR
NT seq 759 nt NT seq  +upstreamnt  +downstreamnt
atgtccggtacccatattcatagacaagctcagcctttttttcttaaaggggatagccgg
gtggccttgctctttatccacggctttaccgcttcaccttccgagctctacccggttgcg
gaattgctgcatcagctctgcgcttgcagcataagcggcttactattgccgggccatgga
agcaggccggaggacttgaacctttgccgctggcaggactggtttgccgccgtaaaaaca
gcattattgaatttgcaggaggaatatgccgaagttttcgtggtgggtctttccatggga
ggactgctggcattgtactccggacttcatgtaccaggcgtctgtggggtatcatccata
aacgcccccgtttttcagcgctccaccctgacgaccgccctggctcctcttatcaaaata
ttccggccttactggcccaagcaggagcagggacggcagcggcaactggaagcagaggga
aggttcgcctacgactgctttcccctgcacgcttttcagagtatgatggaattgcgaaat
caggtggtgcgggagctgggagatttgaaagttcctgtgcttataatgcagtcgcaaaat
gatgaggtggtgaaaagcgaaagtggcaggtatttggccgcacagcttcgccatagggag
gcaaggctggtggaattagagaattccgaacatgttgctaccatgggaccagagaagaag
aaaattgcccacgaattggccgagtttataacgaggtga

DBGET integrated database retrieval system