KEGG   Syntrophomonas wolfei: Swol_0361Help
Entry
Swol_0361         CDS       T00396                                 

Definition
(GenBank) tryptophan synthase, beta chain (EC:4.2.1.20)
  KO
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
swo  Syntrophomonas wolfei
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:swo00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Swol_0361
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Swol_0361
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Swol_0361
Enzymes [BR:swo01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Swol_0361
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
431640..432836
Genome map
AA seq 398 aa AA seqDB search
MMYPDERGYFGRYGGRFVPETLIPALMETEEAYRELAGDEKFQQELQLYLKDYVGRESPL
YFASRLSENAGKARIFLKREDLNHTGSHKINNTLGQALLARKMGKKRLIAETGAGQHGVA
TATAAAAFGLECTVYMGSKDMERQRLNVFRMQMLGAEVRGVKKGSETLKDATNEAFRDYI
RSFEYSHMVIGSVVGPHPYPMMVRDFQAVIGRELRRQFQEQEGGLPDCIIACVGGGSNAM
GIFYPFLEDPVKLLGVEAGGCGTAPGQHCATLSRGNDGVLHGAFSRLLQDEYGQVMDTHS
ISAGLDYPGVGPEHASLRERGRVDYVQMSDREALDAFVQLCRMEGIIPALESAHAVAYAL
KIAAALEEEKSLVVNLSGRGDKDVEEVARLLGGVGNGN
NT seq 1197 nt NT seq  +upstreamnt  +downstreamnt
atgatgtacccagatgaacgtggttattttggccgctacgggggaagattcgtaccggaa
accctgataccggccttgatggaaacggaagaggcttaccgggaattggccggagatgag
aagttccagcaagagctgcaattatatctaaaggactatgtgggccgagagtcgcccctg
tattttgcctcccgcctgagcgaaaacgcagggaaagcccggatatttctcaagcgggag
gatctcaaccataccgggtcccataagattaataataccctggggcaggccctgctggcc
cgtaaaatgggcaaaaaaaggctcatagccgagaccggagccgggcagcatggagtggca
acggcaacggcggcggcggctttcggcctggaatgtacggtatatatgggcagcaaagat
atggaaaggcaaaggctgaatgtctttcgtatgcagatgctgggagcggaggtccgggga
gtaaaaaaaggcagtgaaaccctgaaggatgctaccaatgaagcttttcgcgattacatc
cgcagttttgaatattcccatatggtaataggttcggtagtcggccctcatccctatccc
atgatggtccgggattttcaagcggtgattggccgggagctacggcggcagttccaggaa
caggagggggggcttcccgactgcattatcgcctgtgtaggcggaggcagcaatgccatg
ggaatcttctatcctttcctggaggacccggtaaaactgctgggggtggaagccggaggc
tgcggtacggcaccgggtcagcactgtgccaccctttcccggggcaatgacggggtattg
cacggggccttcagccgtctcctgcaggatgaatacgggcaggtgatggatacccattcc
atatccgctggtctggattaccccggagtgggaccggaacacgcctctttacgggaaaga
ggaagggtggactatgttcagatgagcgaccgggaggctctggatgcctttgtgcagctc
tgccggatggaaggaataatcccggcattggagagtgcccatgcagtggcttatgcctta
aaaatagccgcagccctggaagaagaaaaaagcctggtcgtaaatctatccggccgggga
gacaaggatgtggaagaagtggcccgtttgctgggaggtgtcgggaatggaaattag

DBGET integrated database retrieval system