KEGG   Syntrophomonas wolfei: Swol_0362Help
Entry
Swol_0362         CDS       T00396                                 

Definition
(GenBank) tryptophan synthase, alpha chain (EC:4.2.1.20)
  KO
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
swo  Syntrophomonas wolfei
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:swo00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Swol_0362
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Swol_0362
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Swol_0362
Enzymes [BR:swo01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Swol_0362
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
432826..433605
Genome map
AA seq 259 aa AA seqDB search
MEIRNRLAQLREKEEMALIAFIMAAVPDEDLCLDCIRALEQGGCDLLELGVPFTDPLADG
EVIERFHHWGVRLGLNLKRGLDFAARVRAACQLPLILFSYYNPILQMGLDRFAGDCRSAG
VDAVIVPDLPLDELGRLAGQGLELIPMLAPSSTLSRIQMAADLDPAFIYCVSVRGVTGVR
SLPEMEIKDYLQKVRRVSTAPLALGFGISQPEQVRAFRGQADGVVIGSALAQIIEEYESR
PALLPGMLEKRCQALKLLS
NT seq 780 nt NT seq  +upstreamnt  +downstreamnt
atggaaattagaaatagattggctcaactgagggaaaaggaagaaatggccctgatagcc
tttattatggcagcagtccctgatgaagatttatgcctggactgtatccgggctctggag
caagggggctgtgatttgctggagctgggggtacctttcacggacccgctggctgacggt
gaagtgatagaaagatttcatcactggggggtaaggctgggactgaacctgaaacggggg
ctggattttgccgcccgggtgcgggcagcctgccagttgccgcttatccttttttcctat
tacaatcccatattgcaaatgggtttggacagatttgccggggattgccgctcagcgggg
gtagacgcggtgatagtaccagatctgcctttggatgagttgggaaggctggccggccag
ggcctggagctgattcctatgctggctcccagcagtaccttgtcgcggatacagatggcg
gcggatttggaccctgcctttatatattgcgtttcggtacgcggagtgaccggggttagg
tccctgccggagatggaaatcaaggattacctgcaaaaagtaagaagagtaagcacggct
cccctggccctgggttttggcatatcccagcccgagcaggtcagggctttccgggggcag
gcagatggagtagtaatcgggagcgccctggcccagattattgaagaatacgagtcccgc
cccgccctcctgcccggaatgctggagaagaggtgccaggcacttaagttgttaagttaa

DBGET integrated database retrieval system