KEGG   Syntrophomonas wolfei: Swol_0445Help
Entry
Swol_0445         CDS       T00396                                 

Definition
magnesium chelatase (EC:6.6.1.1)
Orthology
K03405  
magnesium chelatase subunit I [EC:6.6.1.1]
Organism
swo  Syntrophomonas wolfei
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of cofactors and vitamins; Porphyrin and chlorophyll metabolism [PATH:swo00860]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
526159..527367
Genome map
AA seq 402 aa AA seqDB search
MIPFYKLERYEGNAPLFDLTMMSIVSTYVGEPLHVHAEGVRGTGKTTIARAARGILPKIK
RIKDCIYNCDPDNPHCPQHRDLTAAEIEALGVEEITMPFLEISQSAKVGTVAGSIDLARL
TDPLHPEARLLPGLIPQAHRGIIFIDEINRLADTSPEITDILLDVMGNKPGHIQIEEAGL
PVVEIPVSVSVWAASNPDEEPGPLEEIRRQLSDRFDMVYYMGRPDSVEAIARILKENSYA
FKVSQAKKKYSTAEDEAQNDVYRQKILKWAENYRNADLPDYLRNYISRLYIKHNLESIRA
TEAMQQGALLHSIIKGHDKVLISDVTDMIPLVLKHRVNGDVLVRMLNDVDMKGAKEGILS
FKSKKNKKDEETSPDYFQQVARPLKDMSRGELVNTEKTLTPT
NT seq 1209 nt NT seq  +upstreamnt  +downstreamnt
atgataccattttataagcttgaaagatacgagggtaatgcacccttgtttgacctgaca
atgatgtccatagtttcaacttatgttggtgaacccttgcatgttcatgcagaaggagtc
agaggtacggggaagactactatagcaagagcagcgcgaggaatccttcccaagattaaa
cgcattaaagattgtatatataactgtgacccggataacccccattgcccgcaacaccgt
gatttaactgcggcggagattgaagctctgggtgtagaagaaattactatgccctttttg
gaaatatcgcaatcagctaaagtcgggacggtagctggaagtattgatttagccaggttg
actgacccgcttcacccggaagcacgtttacttcccggactaatcccccaggctcaccgg
ggaatcatattcattgatgaaataaaccgcctggcggatacttcaccggagattactgat
atcttacttgatgttatgggtaataaacccggtcatattcaaattgaggaagctggttta
cctgtggtggaaatcccggtaagtgtttcggtttgggcagcttccaaccctgatgaggaa
ccgggaccgttggaagaaataaggcggcaattatcagaccgctttgacatggtctattat
atgggccgaccagattcagtggaggctatagcccggatactaaaagagaattcttatgct
tttaaggtcagtcaggccaaaaagaaatactcaaccgcagaagatgaggcccagaatgat
gtttatcgtcaaaaaatcctcaaatgggctgaaaactaccggaatgcagacctgccagat
tatcttcgcaattatatttcacgcttgtatataaaacataatcttgaaagtatcagagca
accgaggccatgcaacagggagcccttttgcacagtatcatcaaaggccatgacaaagtt
ctaattagtgatgttacggacatgatacccctggtcctgaaacatcgtgttaatggtgat
gttttagtgcggatgctcaacgatgttgatatgaaaggtgccaaggaaggaatactcagc
ttcaagagcaagaagaacaagaaggacgaggaaacttcccccgattatttccagcaggtg
gcgcgtcctctgaaggatatgagccggggagagctggttaataccgaaaaaactttaact
cccacctga

DBGET integrated database retrieval system