KEGG   Syntrophomonas wolfei: Swol_0446Help
Entry
Swol_0446         CDS       T00396                                 

Definition
Mg-chelatase subunit ChlD-like protein
Orthology
K03404  
magnesium chelatase subunit D [EC:6.6.1.1]
Organism
swo  Syntrophomonas wolfei
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:swo00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Swol_0446
Enzymes [BR:swo01000]
 6. Ligases
  6.6  Forming nitrogen-D-metal bonds
   6.6.1  Forming coordination complexes
    6.6.1.1  magnesium chelatase
     Swol_0446
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
527388..529166
Genome map
AA seq 592 aa AA seqDB search
MLGENTNVDKSASVGNYLNLYFGQNQGVRLGESSVVSLRGHARMPEKRVKGQVKILLNRD
AGKMYLDFVEANQVVHIDVFHQPGEIDPRDVARAIFWALDEHFLEKDPQLQFAEDERVKM
VTEYAKKIFITTSLGKGVIYELYQDQVKPFIEGEEGFDHVHVLARLDREEYYLVYVIAEA
VEEVIISSGIKPVKVRNIIHGNQKQAEDSFAGYIKLPWKNFKGQNAYKLPDKENVNQLIL
KLAEKFGGVDEIEEFMENYSTNIFKRKGVDQQKKKWGDVEHYVEQLEELGLIKDTILGKV
MTRKGLQLKDFVINHKCELETEIRRNMRKMPSGGNSRFRKLGQVDQKQTQVEFTNRNKTV
NNPDKNWSGDLAVPETIVQAMKNSFLRNDPHFTIKKEDLHYYDKKSYVPIDVCLLIDASG
SMAGDKRQAACFLAQNLLLSGKEKVAVVTFQERSSEVVVPFTRNQNILNKGLSTISPAGL
TPMADGIMTAVNLIKNNRVRNPLLVLISDGIPNIPLWTLDAQADALEAATHIRENKIHFI
CIGLESNRFYLEKLSANAGGALYLVDDLNKDNLINIVRHEKKNMLESGKKMA
NT seq 1779 nt NT seq  +upstreamnt  +downstreamnt
atgctcggtgaaaacaccaatgttgacaagtcggcatcggtagggaactatttgaacctt
tatttcgggcaaaaccagggcgtaaggctgggggagagtagcgtagttagtctccggggg
cacgcccggatgccggaaaaaagagtaaaaggccaggtcaaaatcctgcttaatcgtgat
gcgggaaagatgtacctggatttcgtagaagctaatcaggtggtgcatattgatgtcttc
caccagccgggtgaaatagacccgcgtgatgtggcgagggcgatattctgggctttggat
gagcattttttggagaaagacccccagttgcagtttgctgaagatgaacgtgtaaaaatg
gtaaccgaatatgccaaaaagatattcattaccacaagcctgggtaagggtgttatctat
gaattgtaccaggaccaggttaagcctttcatcgaaggagaggaaggttttgatcatgtt
catgttcttgcccgtttggatcgtgaagagtattacctggtatatgtaatagcagaagca
gttgaagaagtaattataagctctggtataaagccggtaaaagttcgtaatataattcat
ggcaaccagaagcaggcggaagatagctttgctggatatattaaattgccctggaagaac
ttcaaaggacaaaatgcctacaagctgccagacaaagaaaatgtgaaccagttgatatta
aaactggccgagaaatttggtggagttgatgagattgaggaattcatggaaaactattcc
accaacattttcaaacgtaaaggggttgaccagcagaagaagaagtggggcgatgtagaa
cattatgttgaacaactggaagaattggggttgattaaagataccatcctgggtaaagtg
atgaccaggaaaggcctgcagcttaaagattttgtaataaaccataagtgcgagctggaa
actgaaattcgtcgcaatatgcgtaaaatgccctcaggagggaacagtcgcttccgtaaa
ctggggcaggttgatcagaagcaaacccaagtagaatttaccaaccgtaataaaacggtc
aataacccggataagaattggtccggagatttggcagtaccagagaccattgtgcaggcg
atgaagaacagttttttaagaaacgatcctcacttcaccattaaaaaggaagacctgcat
tattatgacaagaagagttatgtaccgattgatgtgtgtcttttaatcgatgccagtggg
agtatggccggagacaagcgacaggctgcttgcttcctggctcagaatcttcttcttagc
ggaaaagaaaaagtggcagtggttaccttccaagaacggagcagtgaggtggttgtacct
tttacccgtaaccagaacattcttaacaaggggctgtctaccataagcccggcaggtctt
acgcccatggccgatggtattatgactgcggttaacttgattaagaacaaccgggtgaga
aatcctttgctggttctgatatcagatggtattcccaatatccctctctggactttggat
gcccaggcagatgctctggaagctgctactcatattcgggaaaacaagattcattttata
tgtatcggactagagtcaaatcgtttttacctggaaaaattatcagccaatgctgggggt
gccctttatctggttgacgatttgaacaaagataatctcattaatatagtccgccatgaa
aagaaaaacatgttggaaagtggaaagaaaatggcttaa

DBGET integrated database retrieval system