KEGG   Syntrophomonas wolfei: Swol_0644Help
Entry
Swol_0644         CDS       T00396                                 

Definition
(GenBank) tryptophan synthase, beta chain (EC:4.2.1.20)
  KO
K06001  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
swo  Syntrophomonas wolfei
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:swo00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Swol_0644
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Swol_0644
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Swol_0644
Enzymes [BR:swo01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Swol_0644
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
735981..737342
Genome map
AA seq 453 aa AA seqDB search
MSRDELTKIILPEDKIPKFWYNVQADMPHPLEPGLHPQTHQPLTPSDLEPIFARELILQE
VSSERFIEIPREIRELYKQYRPSPLFRARQLEAALQSNCRIYYKYEGVSPVGSHKLNSAL
PQVYFNKVQGIKRISTETGAGQWGTALALACKHFGLEAMIYMVKVSFYQKPYRRSIMELY
GGRCIPSPSNLTESGRQVLARDPETPGSLAIAISEAVEDAVTRDDTNYSLGSVLNHVCLH
QSIIGQEVKMQMELVDDYPDIIIGCCGGGSNFAGIAFPFIPDKLAGKNIRLVAVEPAACP
TLTQGVYAYDYGDVAGFTPLMKMYTLGHDFIPSGIHAGGLRYHGESPLVSRLYHDKLIEA
VAVKQNPTFEAAMLFAQTESIVPAPESAHAIRVAIDEALKAKEEGVSRTIVFNLSGHGHL
DLFSYDKYLSGETEDVEFSDAELKESLRNLPQI
NT seq 1362 nt NT seq  +upstreamnt  +downstreamnt
atgagtagagacgagctaaccaagattattctgcccgaggataagatccccaagttttgg
tataatgtccaggcggatatgccccatcccctggaaccgggattacacccgcaaacccat
caacccctcactccatctgatttggaacccatatttgcccgggagctgattctccaggaa
gtatccagtgaaaggtttattgagataccccgggaaatccgggagctttataaacagtat
cggccctccccgctctttagagcccgccaactggaagcagctctgcagagcaactgccgg
atttattataaatatgaaggggtaagcccggtaggaagtcataagcttaactcggccctg
ccccaggtttatttcaataaggtgcagggtattaagagaataagtactgaaacgggagct
ggccagtggggtacagcactggctctggcctgtaaacactttggcctggaagccatgatt
tatatggtcaaggtaagtttttaccagaaaccctaccggcgctctatcatggaattatac
ggagggcgctgcatacccagccccagcaatcttactgagagtggtcgtcaggttctggct
cgggacccggaaaccccgggaagcctggctattgccattagtgaagcggtagaggatgcg
gttacccgggatgacaccaattattccctgggcagtgtcttgaaccatgtttgcctgcat
cagagcattattggccaggaagtgaagatgcagatggaactggtggatgattacccggat
ataattattggctgttgtggcgggggcagtaattttgcgggaatagcctttcccttcatc
ccggacaaactggccgggaagaatattcgcctggtggcggtagaacctgcggcctgtccg
accctgacccaaggggtttatgcctatgactatggtgatgtggccggtttcaccccgctc
atgaaaatgtataccctgggtcatgattttatcccctccggaattcacgcgggcggcttg
cgttatcatggggaatcccccctggtcagccgtctctatcacgataaactgattgaagca
gtggcggtcaagcaaaacccgaccttcgaagccgctatgctttttgcccagactgagagt
atagtaccggctccagaatcagctcatgctattcgggtagccatagacgaggccctgaaa
gccaaagaagaaggggtttcccgcactattgtctttaatttgagcgggcatggtcatctc
gaccttttctcctatgataaatatctgtctggggaaacggaagatgttgaattttctgat
gctgaattaaaggagagcttgagaaacctgccccagatctaa

DBGET integrated database retrieval system