KEGG   Syntrophomonas wolfei: Swol_0821Help
Entry
Swol_0821         CDS       T00396                                 

Definition
UDP-N-acetylmuramyl-tripeptide synthetase
Orthology
K01928  
UDP-N-acetylmuramoyl-L-alanyl-D-glutamate--2,6-diaminopimelate ligase [EC:6.3.2.13]
Organism
swo  Syntrophomonas wolfei
Pathway
Lysine biosynthesis
Peptidoglycan biosynthesis
Class
Metabolism; Amino acid metabolism; Lysine biosynthesis [PATH:swo00300]
Metabolism; Glycan biosynthesis and metabolism; Peptidoglycan biosynthesis [PATH:swo00550]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
937478..938947
Genome map
AA seq 489 aa AA seqDB search
MKLVELIKNLTIELQDGPLDREISGIAYDSRRVKPGDLFICISGLKSDGHLFAGQAIENG
AVAVLAERQLDTGGKATLLTTPDTRSALALLAANYYGRPSKSIRVVAVTGTNGKTTTTDL
IKAILEEAGKKTAIMGTLYAQVGEIQREMQHTTPEALEIESFMALCREEKADYIVMEVSS
HALQLQRVAEIDFNVAVFTNLTQDHLDFHQNMDNYRAAKLQLFQMIKEEKQNYAIINIDD
PWAEEIFQAATIPCRSYGIKKRSDYQAGELKIDLDGSSFRLHYGDNSLMINMKLIGLFSI
YNALAAISFALQEGIDPGLIQSALARVEGVPGRFEKVDCGQDFAVIVDYAHTPDGLENIL
QTSRELGKKRLICVFGCGGDRDRSKRPLMGEIAAKYSDFCVVTSDNPRSEDPHAIIAEII
PGMDKVEKSRYAIIVDRREAIRHAIHLARTGDLVVIAGKGHENYQLVKDQVLEFDDRKVA
AELLRGKVK
NT seq 1470 nt NT seq  +upstreamnt  +downstreamnt
ttgaagctggtggaattaattaaaaatttaaccatagagctgcaagatggtcctttagat
agggagattagtggaattgcttatgattccagacgggtaaaaccaggagatctttttatc
tgcattagcggcttaaagagtgatggacatctttttgccgggcaggcaattgagaatgga
gccgtggcggttttggccgaaagacagctggatacgggaggaaaagcgactttgcttact
acccccgacacccggagtgccctggccttgttggctgccaattattatggccggccttct
aaatccattagggtggttgcagttaccggaaccaatggtaaaaccacaacaacggatcta
atcaaagctattttggaagaggcgggcaagaaaacggccataatgggtactctttatgcc
caggtcggcgaaattcaaagagagatgcaacacactaccccggaagctttggagatagag
agttttatggccttatgccgggaggaaaaggccgactatatagtaatggaggtctcatcg
cacgctttgcagctgcagcgggtggcagagatagatttcaatgtggcggtatttaccaac
ctgactcaggaccacctggattttcatcaaaatatggataattaccgggcagccaagctt
cagctctttcaaatgataaaagaagaaaagcaaaactatgccattatcaatatcgatgac
ccctgggccgaagagatttttcaggctgccaccatcccttgccgtagttatggaataaaa
aagagatccgattatcaagccggcgaactcaagattgacttggatggcagtagtttccgc
ctacattacggagataatagccttatgattaatatgaaactcattggtctttttagtatt
tacaatgccctggcggctattagctttgctctgcaggaggggatcgatccaggcttaatt
caatcggctctggccagggtggagggggtaccggggcgttttgaaaaggttgattgcggg
caggattttgcggtgattgtagactatgcgcatactcctgatggtttggaaaatattctc
caaacctcccgggagttagggaaaaagcgtttgatttgcgtattcggctgtgggggtgac
cgggatcggagtaaaagaccgcttatgggtgaaattgccgccaaatacagcgatttctgt
gtggtgacttccgataacccgcgtagtgaggatccccatgccattattgcggagataatt
cctgggatggataaggtggaaaagtcccgttatgctataatcgtcgaccgcagagaggct
ataagacatgctattcacctggcgcgaacgggtgatttggtggttatagccgggaaaggg
catgaaaactaccaattggtgaaggatcaggtcctggaattcgatgaccggaaagtggca
gcggaattgttgagaggaaaggtaaaataa

DBGET integrated database retrieval system