KEGG   Syntrophomonas wolfei: Swol_0873Help
Entry
Swol_0873         CDS       T00396                                 

Definition
protein-glutamate methylesterase (EC:3.1.1.61)
Orthology
K03412  
two-component system, chemotaxis family, response regulator CheB [EC:3.1.1.61]
Organism
swo  Syntrophomonas wolfei
Pathway
Two-component system
Bacterial chemotaxis
Brite
KEGG Orthology (KO) [BR:swo00001]
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    Swol_0873
 Cellular Processes
  Cell motility
   02030 Bacterial chemotaxis
    Swol_0873
Enzymes [BR:swo01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.61  protein-glutamate methylesterase
     Swol_0873
Two-component system [BR:swo02022]
 CheA family
  CheA-CheYBV [MD:M00506]
   Swol_0873
Bacterial motility proteins [BR:swo02035]
 Flagellar system
  Chemotaxis proteins
   Two component system proteins
    Swol_0873
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
991683..992741
Genome map
AA seq 352 aa AA seqDB search
MPRKKVLVVDDSAFMRKMIGDMINSDDELEIVGKAGNGQEALEKIRELQPDVVVMDIEMP
VLDGLSTLSRIMESQALPVIIFSSLSQKGTEQTLKALQLGAVDFIAKPSGQISLDVLSVK
EELIKKLKVAANTSRKLPVYQSLHEPVVKAKKSLPDQDRKLNKLVVIAASTGGPKALHQV
IPRFPAGIDAAILVVQHMPPGFTRSLAERLDSLSELRVKEAEHGEKVLPACVYIAPGDYH
LKAKSRLKGTENELYIELDQSKPRGGLRPAADIMLKSVAKQFWSHIVCVIMTGMGNDGAA
ALPCIKEKKGRIIAEHQSTCVVYGMPKAAVETGLVDKIVPLSEITEEVLSML
NT seq 1059 nt NT seq  +upstreamnt  +downstreamnt
atgcccaggaagaaagtgctggtggttgacgactccgccttcatgcgcaagatgattggc
gatatgataaatagcgacgatgagctggaaatagtggggaaagctggcaatgggcaagag
gccctggagaagattagagaactgcaaccggatgtagttgtcatggatattgaaatgccg
gttcttgatggtttatcaacattaagccggataatggaatcccaagcgttaccagtaata
atattcagcagtcttagccaaaaaggcacggaacaaactttaaaagccttacagttgggt
gcggttgattttattgctaagccatcagggcagatatctttggatgttttaagtgttaaa
gaggaacttataaaaaagctcaaggtagcggcaaataccagtagaaaactaccagtatac
caaagtctacacgagccggttgtcaaagccaaaaaatcattaccagaccaggatagaaaa
ttaaataaactggtggtaatcgctgcctctaccgggggacccaaagccctgcatcaggtc
atacctcgtttcccggctggtattgatgccgctattttggtagtacaacatatgccgccg
ggttttaccagatcactggcggaaagactggattcattgtcggaactcagagtgaaggag
gctgagcatggagaaaaagtgctgcctgcttgcgtttatatagcccccggtgattatcat
ttaaaagctaaatcacgcttaaagggtacggaaaacgaactatatattgaactggatcaa
tccaagccccggggaggattgcgcccggcggctgatattatgttgaagtcggtagctaaa
caattctggtctcatatagtatgtgtaattatgacgggtatgggtaatgatggggccgca
gcattgccatgtataaaggagaagaagggaagaattattgcggaacatcagtctacttgt
gttgtatatggtatgcccaaagcggcagtggaaacaggtttggtcgataagatagttccg
ctatcggaaatcactgaggaagtattaagtatgctgtaa

DBGET integrated database retrieval system