KEGG   Syntrophomonas wolfei: Swol_1170Help
Entry
Swol_1170         CDS       T00396                                 

Definition
6-phosphofructokinase (EC:2.7.1.11)
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
swo  Syntrophomonas wolfei
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
RNA degradation
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:swo00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Swol_1170
   01230 Biosynthesis of amino acids
    Swol_1170
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Swol_1170
   00030 Pentose phosphate pathway
    Swol_1170
   00051 Fructose and mannose metabolism
    Swol_1170
   00052 Galactose metabolism
    Swol_1170
  Energy metabolism
   00680 Methane metabolism
    Swol_1170
 Genetic Information Processing
  Folding, sorting and degradation
   03018 RNA degradation
    Swol_1170
Enzymes [BR:swo01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     Swol_1170
Protein phosphatases and associated proteins [BR:swo01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     Swol_1170
Messenger RNA biogenesis [BR:swo03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     Swol_1170
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1354761..1355858
Genome map
AA seq 365 aa AA seqDB search
MKEIRHIGILTGGGDCPGLNAVIRAISKTAINYGVEVIGFIDGFKGLVENRYIQLDLRAV
SGISHTGGTILGTSNRDNPFQFFTISEGTPQHSDESDRAVANMEHLGLDGLVVIGGDGSL
NIADRFAEKGVPIVGVPKTIDNDLSATDVTFGFNTAVNTASEALDRLHTTAESHHRVMVL
EVMGRYAGWIALHAGISGGADVILIPEIPYNMDAVISKITQRYRQGKNFSIIVVAEGAIP
EDGEMVIRNLVATSHDPIRLGGIGQKVAEDIGNRLQNIEVRVTVLGHLQRGGSPIPYDRI
LSTRYGVAAVDAFMAGQFGTMVSLRGDMIAAVPIKEAIKEIRRVKPESDLVRAARAVGIS
FGDKY
NT seq 1098 nt NT seq  +upstreamnt  +downstreamnt
atgaaagaaattcgtcatataggaattctaaccggtggaggcgattgcccaggattgaat
gcagtaatacgcgctatttctaaaacagctatcaattatggggtagaagtaattggtttt
attgatggttttaagggtttggtggaaaaccgatatatacaactggacttgcgtgcagta
tcggggattagtcatacgggtggtactattctgggcaccagcaaccgggacaaccctttt
caattctttactatcagtgagggaaccccccagcatagtgacgaatccgaccgggccgtt
gccaacatggaacatttgggacttgatggattggtggtaatagggggtgatggaagcctt
aatattgctgaccgttttgcggaaaaaggggtacccattgttggagtacctaaaacaatt
gataatgatttatcggctactgatgttaccttcggttttaatacggcggtaaataccgct
tcggaagctttggataggctccataccacggctgaatcacaccaccgggtaatggttttg
gaagtaatgggacgctatgccggatggatagcacttcacgcaggtatttccggtggggca
gatgttatattaattccagagataccctataatatggatgccgtaataagcaaaataaca
cagcgctaccgccagggtaaaaattttagtattattgtagtggctgagggagcaattccc
gaagatggagaaatggttattagaaatctggtggctaccagccatgatcccataagatta
ggaggaataggccagaaagtagccgaggacatcggtaatcgcttacaaaatatcgaagtt
agggtaacagtgctgggtcatttacagcgaggaggttctcctattccctacgaccggata
ctttccactcgctatggtgtagcggccgtggacgccttcatggcgggacaatttggtacc
atggtaagcctgcggggggacatgatagctgccgtaccgataaaggaggctataaaggaa
atacggagagtaaaaccggagagtgatttggtaagggcagcccgggctgtaggtataagc
tttggggataagtattaa

DBGET integrated database retrieval system