KEGG   Syntrophomonas wolfei: Swol_1170Help
Entry
Swol_1170         CDS       T00396                                 

Definition
6-phosphofructokinase (EC:2.7.1.11)
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
swo  Syntrophomonas wolfei
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Class
Metabolism; Overview; Carbon metabolism [PATH:swo01200]
Metabolism; Overview; Biosynthesis of amino acids [PATH:swo01230]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:swo00010]
Metabolism; Carbohydrate metabolism; Pentose phosphate pathway [PATH:swo00030]
Metabolism; Carbohydrate metabolism; Fructose and mannose metabolism [PATH:swo00051]
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:swo00052]
Metabolism; Energy metabolism; Methane metabolism [PATH:swo00680]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1354761..1355858
Genome map
AA seq 365 aa AA seqDB search
MKEIRHIGILTGGGDCPGLNAVIRAISKTAINYGVEVIGFIDGFKGLVENRYIQLDLRAV
SGISHTGGTILGTSNRDNPFQFFTISEGTPQHSDESDRAVANMEHLGLDGLVVIGGDGSL
NIADRFAEKGVPIVGVPKTIDNDLSATDVTFGFNTAVNTASEALDRLHTTAESHHRVMVL
EVMGRYAGWIALHAGISGGADVILIPEIPYNMDAVISKITQRYRQGKNFSIIVVAEGAIP
EDGEMVIRNLVATSHDPIRLGGIGQKVAEDIGNRLQNIEVRVTVLGHLQRGGSPIPYDRI
LSTRYGVAAVDAFMAGQFGTMVSLRGDMIAAVPIKEAIKEIRRVKPESDLVRAARAVGIS
FGDKY
NT seq 1098 nt NT seq  +upstreamnt  +downstreamnt
atgaaagaaattcgtcatataggaattctaaccggtggaggcgattgcccaggattgaat
gcagtaatacgcgctatttctaaaacagctatcaattatggggtagaagtaattggtttt
attgatggttttaagggtttggtggaaaaccgatatatacaactggacttgcgtgcagta
tcggggattagtcatacgggtggtactattctgggcaccagcaaccgggacaaccctttt
caattctttactatcagtgagggaaccccccagcatagtgacgaatccgaccgggccgtt
gccaacatggaacatttgggacttgatggattggtggtaatagggggtgatggaagcctt
aatattgctgaccgttttgcggaaaaaggggtacccattgttggagtacctaaaacaatt
gataatgatttatcggctactgatgttaccttcggttttaatacggcggtaaataccgct
tcggaagctttggataggctccataccacggctgaatcacaccaccgggtaatggttttg
gaagtaatgggacgctatgccggatggatagcacttcacgcaggtatttccggtggggca
gatgttatattaattccagagataccctataatatggatgccgtaataagcaaaataaca
cagcgctaccgccagggtaaaaattttagtattattgtagtggctgagggagcaattccc
gaagatggagaaatggttattagaaatctggtggctaccagccatgatcccataagatta
ggaggaataggccagaaagtagccgaggacatcggtaatcgcttacaaaatatcgaagtt
agggtaacagtgctgggtcatttacagcgaggaggttctcctattccctacgaccggata
ctttccactcgctatggtgtagcggccgtggacgccttcatggcgggacaatttggtacc
atggtaagcctgcggggggacatgatagctgccgtaccgataaaggaggctataaaggaa
atacggagagtaaaaccggagagtgatttggtaagggcagcccgggctgtaggtataagc
tttggggataagtattaa

DBGET integrated database retrieval system