KEGG   Syntrophomonas wolfei: Swol_1374Help
Entry
Swol_1374         CDS       T00396                                 

Definition
(GenBank) pyruvate synthase subunit porB
  KO
K00170  
pyruvate ferredoxin oxidoreductase beta subunit [EC:1.2.7.1]
Organism
swo  Syntrophomonas wolfei
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Nitrotoluene degradation
Propanoate metabolism
Butanoate metabolism
Methane metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:swo00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Swol_1374
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Swol_1374
   00020 Citrate cycle (TCA cycle)
    Swol_1374
   00620 Pyruvate metabolism
    Swol_1374
   00640 Propanoate metabolism
    Swol_1374
   00650 Butanoate metabolism
    Swol_1374
  Energy metabolism
   00680 Methane metabolism
    Swol_1374
  Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    Swol_1374
Enzymes [BR:swo01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.1  pyruvate synthase
     Swol_1374
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
complement(1589782..1590720)
Genome map
AA seq 312 aa AA seqDB search
MSTVYNLKREVEKPTRLTGGHRLCAGCGTGVVVSGVLRALDREDRAVVVNATSCLEVSTF
MYPYTAYMDSYIHSAFENSAATCSGVEAAYNALKRCGKVEGTVKFITFAGDGGTYDIGFQ
SLSGAMERGHDMVYVCYDNEAYMNTGIQRSSSTPRFARTTTTPVGSVGQGKKQNKKDLTE
ILVAHNIPYVAQTAPVGNFRDLHSKSYKAIYTEGPCFLNILSPCPRGWDYPMAMLAEIIK
LAVDTCVWPLYEVEEGVWRLSYIPKRKLPVEDFLRPQGRFRHMFQKGNEWMIEEAQSYVD
QKWERLLEHTGA
NT seq 939 nt NT seq  +upstreamnt  +downstreamnt
atgagcacggtatataacctgaagcgggaagtagaaaaaccgacccgtctcaccggaggg
catcggctttgtgccggctgtggcaccggggttgttgtgtcgggggttctgcgtgccctg
gatagagaggaccgggcagtggtggttaatgctaccagttgtctggaggtctccaccttt
atgtatccttacactgcctatatggatagctatattcattctgcttttgagaactctgcg
gcaacctgttccggagtggaagcagcatataatgctttgaaacgctgcggcaaggtggaa
ggaaccgtcaagtttattacctttgccggtgacggcggcacctatgatatagggtttcaa
tccctgtcaggagctatggaacgcggtcatgatatggtctatgtctgctatgacaacgag
gcttatatgaataccggaatccagcgttcatcttcaacgcctcgttttgcccgcacgact
actacgccggtaggttctgtagggcagggtaagaaacagaataaaaaggatctgacggag
attttggttgctcataatatcccctatgtggctcagactgcccctgtaggcaatttcagg
gatttgcacagcaagtcttacaaagccatttatactgagggcccttgctttttgaacata
ttgtccccatgtcctcgcggatgggactaccccatggctatgctggcggagatcattaag
ctggccgtggatacctgcgtctggcccctttacgaagtagaggagggagtatggcgtctg
agctatataccgaagagaaagctgcccgtggaagactttctccgtcctcagggtagattc
cgccacatgttccagaaaggcaatgagtggatgattgaagaagcgcagagctatgtggat
caaaaatgggaacgcttactggaacataccggtgcttaa

DBGET integrated database retrieval system