KEGG   Syntrophomonas wolfei: Swol_1376Help
Entry
Swol_1376         CDS       T00396                                 

Definition
pyruvate synthase subunit porD
Orthology
K00171  
pyruvate ferredoxin oxidoreductase, delta subunit [EC:1.2.7.1]
Organism
swo  Syntrophomonas wolfei
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Nitrotoluene degradation
Propanoate metabolism
Butanoate metabolism
Methane metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:swo00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Swol_1376
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Swol_1376
   00020 Citrate cycle (TCA cycle)
    Swol_1376
   00620 Pyruvate metabolism
    Swol_1376
   00640 Propanoate metabolism
    Swol_1376
   00650 Butanoate metabolism
    Swol_1376
  Energy metabolism
   00680 Methane metabolism
    Swol_1376
  Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    Swol_1376
Enzymes [BR:swo01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.1  pyruvate synthase
     Swol_1376
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1591907..1592215)
Genome map
AA seq 102 aa AA seqDB search
MIRAKDINELTPWQDLTPGGEIYEAGTARDFNTGTWRTNTPVFHEEACKHCMLCIPFCPD
SAIPVKDGKRLDFDYMHCKGCGICENVCPFPAITMVMGGVAI
NT seq 309 nt NT seq  +upstreamnt  +downstreamnt
atgattcgggcgaaagatatcaatgagcttactccctggcaggatctaacccccggtggg
gagatctacgaagcaggaaccgcccgggacttcaataccggtacctggcgaaccaatacg
cctgtatttcacgaggaagcatgtaaacactgtatgctttgtattccattctgtccggac
agtgctattccggtgaaggacgggaaacgtctggacttcgactatatgcactgcaagggc
tgtggcatctgtgagaatgtatgtcccttcccggcgattaccatggtgatgggaggtgtg
gccatatga

  All links  
No link information was found.   
DBGET integrated database retrieval system