KEGG   Syntrophomonas wolfei: Swol_1408Help
Entry
Swol_1408         CDS       T00396                                 

Definition
GTP cyclohydrolase I (EC:3.5.4.16)
Orthology
K01495  
GTP cyclohydrolase I [EC:3.5.4.16]
Organism
swo  Syntrophomonas wolfei
Pathway
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:swo00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1621403..1621981
Genome map
AA seq 192 aa AA seqDB search
MQKKVIDEAKIEEAVHMILEAIGEDPEREGLQNTPKRVARMYREIFAGMNSNPREFLQVS
FTEFHDELVLVKDIPLYSMCEHHLLPFYGKAHVAYIPRGGKVVGISKLTRVAEAYAMRPQ
LQERLTSQIADCINDSLKPFGVAVVIEAEHMCMTMRGVRKPGALTVTSAVRGIFETRPET
RAEVFSLINQKI
NT seq 579 nt NT seq  +upstreamnt  +downstreamnt
atgcaaaaaaaagtaatagatgaagccaaaattgaagaagctgttcacatgatactggaa
gcaattggggaagacccggaacgggaaggcttgcaaaacaccccgaaaagggtagctcgc
atgtatagagagatatttgccggtatgaattctaaccccagggaattcctgcaggtttcc
tttacagaatttcatgatgaactggtattggtaaaggatattcccttgtattcgatgtgt
gaacaccacttgcttcccttttatggcaaagctcatgtagcctacatcccccgcggtggt
aaagtggtgggaataagcaagttgacccgggtggcagaagcctatgccatgcgcccccag
ttgcaggaaagacttacttcccaaatagccgactgtataaacgatagcttaaagcctttt
ggggtggcagtagtaatcgaagcggaacacatgtgcatgaccatgagaggtgtacgcaag
ccgggagccttaactgtaacctctgccgttcgtggaatttttgagaccaggcctgaaacc
agggctgaagtcttctctcttattaaccagaaaatctaa

DBGET integrated database retrieval system