KEGG   Syntrophomonas wolfei: Swol_1547Help
Entry
Swol_1547         CDS       T00396                                 

Definition
type III restriction system endonuclease
Orthology
K01156  
type III restriction enzyme [EC:3.1.21.5]
Organism
swo  Syntrophomonas wolfei
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1764923..1767892)
Genome map
AA seq 989 aa AA seqDB search
MKLKFVSDQQFQLDAVASISDIFQGQAVKQANFSVASTMGSSAQGELGYQTELGYANKLD
LLDDELLENINRIQLRNGLPKSTDIQGRNFTVEMETGTGKTYVYIRTIYELNKLYGFTKF
IIVVPSVAIREGVNKSLEIMEEHFKSLYEGANCDYFIYDSSKLGQLRTFATSSNIQIMVI
NIDAFRKSFVDPNKPDKANIIHREHDRMNGRRPIEFIQQTNPIVIIDEPQSVDRTDKAKE
AIASLNPLCTLRYSATHVETYNLMYCLGPVDAYQKKLVKEIVVDSIKEAGNFNRPYIRLV
SVKNSNGFQAVLELDIKNRSGVVQRKQKTVRVGQDLFDISGEREIYSGYIINNIDCYPGN
EMVEFTNGSHLPLGMEMGNISGDDIKRGQISATIKHHLDRELRLVPQGIKVLSLFFIDRV
DNYRIYDSNGNPQKGKYALMFEEEYSKLIKLPKYRTLFEDHNYMLNDDPSMVHDGYFSID
KKGRIKDTRGNTLADHDTYNLIMKEKEKLLSFETPLRFIFSHSALKEGWDNPNVFQICTL
IEARETLTRRQKIGRGLRLCVNQEGERIFDPQINTLSVMANESFAEFAENLQSEMEAETG
VKFGFIEKHAFAGISYTDDSGKIENLGYEASENLWGFLLEEDLIYTTGKVKLELKEQIAN
DTFQVPPEFEHVEQEIKQVIRQSLNKLPIRNHNNEVTAQLNKRVYLGPEFESLWNRIKFR
TTYSVAMDIEKLVQECVDAINRMPAIPKVRLIQESARIDINQSGVSGELTSVKVLDQIDI
KHSLPDILRYLQDETRLTRRTIVRILIEARRLEDFKNNPQKFMEAVSDIIKQRMKLMIAD
GIKYERVGNLEFYRQELFEMQELKGYLKSNAIKVEKSVYDYLILDSNTEKEFAQMLEQDD
EVKVYTKLPPKFVIETPIGNYNPDWAVLVDKDGTEKLYFVVETKGSTDSGQLRLFENYKI
ECGKKHFAALETGVTYEVAKDYAEWKLGI
NT seq 2970 nt NT seq  +upstreamnt  +downstreamnt
atgaaactaaaatttgtttccgaccaacaattccagttggatgccgttgcctcaataagc
gacatctttcaaggtcaggcagtaaaacaggctaatttctcggttgcttccaccatgggc
agtagcgctcagggtgaattaggttatcagaccgaacttggttacgctaataaactggac
ctgttggatgacgaactgctggaaaacattaatcgcatccaactgcgcaacggcttacct
aaaagcactgatatccaggggcgcaattttaccgtagagatggagaccggtaccggtaaa
acctatgtttatattcgtactatctatgagcttaataagctttacggatttaccaaattt
attattgtggttccttcagtagctatccgtgaaggggttaataaatccctggagattatg
gaggagcattttaagagcctctatgaaggcgccaactgtgattattttatctacgattcc
tccaagctgggccagttaagaacctttgctaccagttccaatattcagattatggttatt
aatattgatgccttccgtaaaagctttgtggaccccaataaacctgataaagctaatatc
atccaccgcgagcacgaccgtatgaatgggcgcagaccgattgaatttatccagcagacc
aaccccattgtaattatagatgaaccgcaaagtgtggatagaaccgataaagccaaggaa
gctattgcatcgttaaatcccctttgcactttacgctattccgccacccatgtggaaacc
tataatctgatgtattgcctgggaccggtagatgcttatcaaaaaaaattggtgaaagaa
attgtagtagacagcattaaggaagccggaaacttcaaccggccttatattcgcctggta
tcggtcaaaaacagtaatggcttccaggccgttctggaactggacataaagaaccgttcc
ggcgtggtacaaagaaagcaaaaaacagtcagagtagggcaggacctgtttgatatatcc
ggggaaagagaaatttattctggttatattattaacaacattgactgttaccctggtaat
gagatggtggaattcaccaatggtagccacctgccgttaggaatggaaatgggcaacatc
agtggggatgatataaaacggggtcagatcagtgccaccatcaaacaccacctggaccgg
gaactacgcctggttccccagggaataaaagtcctttccctcttttttatagaccgggtg
gacaactaccgcatatatgatagtaacggtaatccccagaagggcaagtatgccttaatg
ttcgaggaagaatatagtaagctgattaaactccccaagtaccgcaccctttttgaagac
cataattatatgcttaatgacgatccatccatggttcatgatggctatttttctattgac
aaaaagggaagaattaaggatacacgtggtaataccctggctgatcacgacacctataat
ttgataatgaaggaaaaagaaaagctgctcagttttgaaaccccgttgcgtttcatcttt
tcccattcagcgctcaaagaaggctgggataatcccaatgtctttcagatatgtaccctg
attgaagcccgggaaaccctaacccgccggcaaaaaattggccgcggcctgcgcctttgc
gtcaatcaagagggggaaaggatatttgacccccagattaacaccctgtcagttatggcc
aatgaatcttttgccgaatttgcggaaaacctgcagagcgaaatggaggccgaaaccggt
gtcaaatttggctttattgagaaacatgccttcgcaggtatatcctataccgacgactcc
ggaaaaattgaaaacctgggttatgaagcatcagagaatctatggggttttcttttagaa
gaagaccttatttatacaactggaaaagttaaactggaattaaaagaacaaattgccaac
gatacctttcaggtgccgccagaatttgagcatgtagagcaggaaatcaaacaggtaata
cggcagtcgctaaataaattgcccatacgtaatcacaataatgaagttactgcccagttg
aacaaacgggtttacctgggaccggagtttgaatccctgtggaaccgcataaaattccgt
accacttattcagttgctatggatattgaaaaactagtgcaagaatgtgtggatgccatt
aacagaatgccggccatacccaaagttcgcctgattcaagagagcgcccgaattgatatt
aaccaatcaggtgtttctggagaattgaccagtgtaaaagttctggaccagattgacatc
aagcattccttgcccgatatcctgcgttatctccaggatgaaaccaggctgacccgaaga
accatcgtaagaatactcatcgaagcccgaaggttggaagatttcaaaaataatccccag
aagtttatggaagccgtaagtgacatcatcaaacaaaggatgaaacttatgattgccgac
ggcatcaaatacgaacgagtcggcaatctggaattttaccggcaggaactgtttgaaatg
caggaactaaaaggctatttaaaatccaatgccataaaagtagagaaatcagtttatgac
tacctcattctggattccaatacggaaaaagaatttgcccaaatgctggaacaagatgac
gaagtaaaagtctacaccaaactgccgcccaaattcgtcatagaaacccccatcggtaac
tacaacccggactgggcagtgctggtagacaaagacggcaccgaaaaactatatttcgta
gtagaaaccaaaggcagcactgacagcggccagttaagactatttgaaaactataagata
gagtgcggcaaaaaacactttgccgccctggaaactggagttacttatgaagtagccaaa
gattatgcggagtggaagttgggaatttaa

DBGET integrated database retrieval system