KEGG   Syntrophomonas wolfei: Swol_2051Help
Entry
Swol_2051         CDS       T00396                                 

Definition
(GenBank) acetyl-CoA acetyltransferase / 3-ketoacyl-CoA thiolase
  KO
K00626  
acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
swo  Syntrophomonas wolfei
Pathway
Fatty acid degradation
Valine, leucine and isoleucine degradation
Benzoate degradation
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Propanoate metabolism
Butanoate metabolism
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Fatty acid metabolism
Two-component system
Brite
KEGG Orthology (KO) [BR:swo00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    Swol_2051
   00630 Glyoxylate and dicarboxylate metabolism
    Swol_2051
   00640 Propanoate metabolism
    Swol_2051
   00650 Butanoate metabolism
    Swol_2051
  Lipid metabolism
   00071 Fatty acid degradation
    Swol_2051
   00072 Synthesis and degradation of ketone bodies
    Swol_2051
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    Swol_2051
   00310 Lysine degradation
    Swol_2051
   00380 Tryptophan metabolism
    Swol_2051
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    Swol_2051
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    Swol_2051
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    Swol_2051
Enzymes [BR:swo01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     Swol_2051
Exosome [BR:swo04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Swol_2051
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
2351277..2352467
Genome map
AA seq 396 aa AA seqDB search
MAREVVLVGACRTPVGTFGGTIKDVGAADLGALVMGEAITRAGIKAEQIDEVIFGCVLQA
GLGQNVARQCMIKAGIPKEITAFTINKVCGSGLRAVSLAAQVIKAGDADIILAGGTENMD
KAPFLLPNARWGYRMSMPKGDLIDEMVFGGLTDIFNGYHMGITAENVNEMYGITREEQDA
FGFRSQDLAAKAIESGRFKDEIVPVVIKGKKGDTVFDTDEHPRKSTPEAMAKLAPAFKKG
GSVTAGNASGINDGAAAVIVMSKEKADELGIKPMAKVVSYASGGVDPSVMGLGPIPASRK
ALEKAGLTIDDIDLIEANEAFAAQAIAVGRDLGWSDKMEKVNVNGGAIAIGHPIGASGAR
ILITLLYEMQKRGAKRGLATLCIGGGMGTALIVEAI
NT seq 1191 nt NT seq  +upstreamnt  +downstreamnt
atggcgagagaagtagtactggttggagcctgccgtacccctgtgggtacattcggaggc
accataaaagatgtaggagctgccgacctgggtgccctggttatgggagaggctataaca
agagccgggatcaaggctgagcagattgatgaagtaatattcggctgtgttcttcaggcc
ggactgggacagaatgtagcccgtcagtgcatgattaaagccggaatccccaaagaaata
accgcttttaccatcaataaggtttgcggctccggcttgagagccgtcagcctagcggct
caggtaattaaagccggagacgctgatatcattttagccggcggaaccgagaacatggac
aaagctccctttttactgcccaatgcccgctggggataccggatgagtatgcccaaaggg
gaccttatcgatgagatggtattcggtggcctgactgatatcttcaacggctatcacatg
ggaataaccgccgaaaatgttaatgaaatgtatggcattacccgggaagagcaagatgcc
ttcggtttccgcagtcaggatctggcggcaaaagctattgaatccggtcgctttaaagac
gaaatagtgcccgtggttattaagggcaagaagggcgataccgtatttgataccgatgag
catccccgcaaaagtacgcctgaagctatggccaaactggctccggccttcaagaagggc
ggcagtgtaactgccggcaatgcttccggcattaacgatggcgccgctgccgttatcgta
atgtccaaggagaaagctgatgagctaggcatcaagcctatggccaaagttgttagctat
gcctccggtggagtggatccctcggtaatgggactgggaccgataccggccagccgcaaa
gccctggaaaaagctggtttaactattgatgacattgacctgattgaagccaacgaagct
tttgctgcccaggctattgccgtaggtcgtgatttgggctggtcggacaagatggaaaaa
gtcaatgtcaacggcggagctatagctataggccatcccatcggagcctcgggagccaga
attctcataacccttttatacgaaatgcagaagcgcggtgccaagagaggcctggctacc
ctctgtatcggcggcggcatgggtacagccctgatcgttgaagctatttaa

DBGET integrated database retrieval system