KEGG   Syntrophomonas wolfei: Swol_2154Help
Entry
Swol_2154         CDS       T00396                                 

Definition
(GenBank) phosphomannomutase
  KO
K15778  phosphomannomutase / phosphoglucomutase [EC:5.4.2.8 5.4.2.2]
Organism
swo  Syntrophomonas wolfei
Pathway
swo00010  Glycolysis / Gluconeogenesis
swo00030  Pentose phosphate pathway
swo00051  Fructose and mannose metabolism
swo00052  Galactose metabolism
swo00230  Purine metabolism
swo00500  Starch and sucrose metabolism
swo00520  Amino sugar and nucleotide sugar metabolism
swo00521  Streptomycin biosynthesis
swo01100  Metabolic pathways
swo01110  Biosynthesis of secondary metabolites
swo01120  Microbial metabolism in diverse environments
swo01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:swo00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Swol_2154
   00030 Pentose phosphate pathway
    Swol_2154
   00051 Fructose and mannose metabolism
    Swol_2154
   00052 Galactose metabolism
    Swol_2154
   00500 Starch and sucrose metabolism
    Swol_2154
   00520 Amino sugar and nucleotide sugar metabolism
    Swol_2154
  Nucleotide metabolism
   00230 Purine metabolism
    Swol_2154
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    Swol_2154
Enzymes [BR:swo01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.2  phosphoglucomutase (alpha-D-glucose-1,6-bisphosphate-dependent)
     Swol_2154
    5.4.2.8  phosphomannomutase
     Swol_2154
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PGM_PMM_I PGM_PMM_II PGM_PMM_III PGM_PMM_IV DUF2218
Motif
Other DBs
NCBI-ProteinID: ABI69445
JGI: Swol2154
UniProt: Q0AV09
Position
2481912..2483261
Genome map
AA seq 449 aa AA seqDB search
MINQSIFRMYDIRGRVGTDLDEVAVRAIAAAFGKYVQERGRDKIIVGRDNRFSSPRFREL
VVETLLLSGLDVVDIGEVITPMFYFASRHLDIDAGMMITASHNPGEDNGFKLLLGNSTIY
GEDILKIAELAEAGGFTSSTNKGNLSFYDISPAYQQDIMKRIKLGERKLKVVVDCGNGTA
GFIAPRLFRELGCEVIELYCDSDPSFPNHHPDPVKVENCQDLIQVVKAERADLGIGFDGD
GDRLGVVDTEGNIIWGDMLMILFWREILPSYPGTDCIVEVKCSQSLIDEINRLGGKPIIY
KTGHSLIKARMKEIGAVFTGEMSGHMFFADEYYGYDDALYAAARLLRILSHSEQSLNELL
ADVPRYHATPELRVKSSDSEKFAVVERVLSHYRNHHEVIDIDGARILFPGGWGLVRASNT
GPELIVRCEAGTPEELERIKAELFAFLEV
NT seq 1350 nt NT seq  +upstreamnt  +downstreamnt
atgattaaccagtctatttttcgtatgtatgatatcagaggcagggtaggtacagatttg
gatgaagttgcggtgagggcaatagccgcggctttcggaaaatatgtgcaggagcggggc
cgtgataagataatcgtgggccgcgataaccgtttttcttcgccgcgctttcgggaactg
gtagtagaaacactcttgctatccggcctggatgtagtagacataggagaggtaattact
cctatgttttattttgcttctcgtcacctggatattgacgcggggatgatgataactgcc
agccataatccaggcgaggataatggtttcaagctgctattgggcaattccaccatatat
ggagaggatattttaaaaatagctgagctggctgaagccggaggttttacgagcagtacc
aataaagggaatctgagcttctatgatatcagcccggcttaccagcaggatattatgaaa
aggataaagctgggagaacggaagcttaaagtggtggtggactgcggcaacggcaccgcc
ggttttattgctcctcgtttattcagggaactgggctgtgaagtgatcgagctttactgt
gactcggacccgagctttcctaatcaccatccggatccggttaaggttgagaactgccag
gatttaatccaggtagtcaaggcggaacgggctgacctgggcataggttttgacggagat
ggagatcgcctgggggtagtggatactgagggcaatattatctggggagatatgttaatg
atccttttctggcgagagatactgcccagctacccaggaactgattgcatagtagaggtc
aaatgctcccagtccctgatagatgagataaatcgtttgggaggcaagcctattatttat
aaaaccggtcattcccttattaaggccaggatgaaagagataggagcagtgtttaccggg
gagatgtccgggcatatgttttttgcggatgaatactatggctatgatgatgctctctat
gctgccgcccggctcttgcgtatcttatcccacagtgagcagagcttgaatgagctcttg
gctgatgtaccccgctaccatgccacccccgaactccgggtgaaaagcagcgatagcgag
aaattcgcggtggtcgagcgggtactctcgcattaccgcaatcaccatgaggtcatagat
atagatggggccaggattctcttccccggcggctggggcctggttcgggcctccaatacc
ggaccggagcttatagtgcgctgcgaagccggaaccccggaagagctggagaggattaaa
gcagagttgtttgccttcctggaagtataa

DBGET integrated database retrieval system