KEGG   Syntrophomonas wolfei: Swol_2154Help
Entry
Swol_2154         CDS       T00396                                 

Definition
phosphomannomutase (EC:5.4.2.8)
Orthology
K15778  
phosphomannomutase / phosphoglucomutase [EC:5.4.2.8 5.4.2.2]
Organism
swo  Syntrophomonas wolfei
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Purine metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:swo00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Swol_2154
   00030 Pentose phosphate pathway
    Swol_2154
   00051 Fructose and mannose metabolism
    Swol_2154
   00052 Galactose metabolism
    Swol_2154
   00500 Starch and sucrose metabolism
    Swol_2154
   00520 Amino sugar and nucleotide sugar metabolism
    Swol_2154
  Nucleotide metabolism
   00230 Purine metabolism
    Swol_2154
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    Swol_2154
Enzymes [BR:swo01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.2  phosphoglucomutase (alpha-D-glucose-1,6-bisphosphate-dependent)
     Swol_2154
    5.4.2.8  phosphomannomutase
     Swol_2154
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2481912..2483261
Genome map
AA seq 449 aa AA seqDB search
MINQSIFRMYDIRGRVGTDLDEVAVRAIAAAFGKYVQERGRDKIIVGRDNRFSSPRFREL
VVETLLLSGLDVVDIGEVITPMFYFASRHLDIDAGMMITASHNPGEDNGFKLLLGNSTIY
GEDILKIAELAEAGGFTSSTNKGNLSFYDISPAYQQDIMKRIKLGERKLKVVVDCGNGTA
GFIAPRLFRELGCEVIELYCDSDPSFPNHHPDPVKVENCQDLIQVVKAERADLGIGFDGD
GDRLGVVDTEGNIIWGDMLMILFWREILPSYPGTDCIVEVKCSQSLIDEINRLGGKPIIY
KTGHSLIKARMKEIGAVFTGEMSGHMFFADEYYGYDDALYAAARLLRILSHSEQSLNELL
ADVPRYHATPELRVKSSDSEKFAVVERVLSHYRNHHEVIDIDGARILFPGGWGLVRASNT
GPELIVRCEAGTPEELERIKAELFAFLEV
NT seq 1350 nt NT seq  +upstreamnt  +downstreamnt
atgattaaccagtctatttttcgtatgtatgatatcagaggcagggtaggtacagatttg
gatgaagttgcggtgagggcaatagccgcggctttcggaaaatatgtgcaggagcggggc
cgtgataagataatcgtgggccgcgataaccgtttttcttcgccgcgctttcgggaactg
gtagtagaaacactcttgctatccggcctggatgtagtagacataggagaggtaattact
cctatgttttattttgcttctcgtcacctggatattgacgcggggatgatgataactgcc
agccataatccaggcgaggataatggtttcaagctgctattgggcaattccaccatatat
ggagaggatattttaaaaatagctgagctggctgaagccggaggttttacgagcagtacc
aataaagggaatctgagcttctatgatatcagcccggcttaccagcaggatattatgaaa
aggataaagctgggagaacggaagcttaaagtggtggtggactgcggcaacggcaccgcc
ggttttattgctcctcgtttattcagggaactgggctgtgaagtgatcgagctttactgt
gactcggacccgagctttcctaatcaccatccggatccggttaaggttgagaactgccag
gatttaatccaggtagtcaaggcggaacgggctgacctgggcataggttttgacggagat
ggagatcgcctgggggtagtggatactgagggcaatattatctggggagatatgttaatg
atccttttctggcgagagatactgcccagctacccaggaactgattgcatagtagaggtc
aaatgctcccagtccctgatagatgagataaatcgtttgggaggcaagcctattatttat
aaaaccggtcattcccttattaaggccaggatgaaagagataggagcagtgtttaccggg
gagatgtccgggcatatgttttttgcggatgaatactatggctatgatgatgctctctat
gctgccgcccggctcttgcgtatcttatcccacagtgagcagagcttgaatgagctcttg
gctgatgtaccccgctaccatgccacccccgaactccgggtgaaaagcagcgatagcgag
aaattcgcggtggtcgagcgggtactctcgcattaccgcaatcaccatgaggtcatagat
atagatggggccaggattctcttccccggcggctggggcctggttcgggcctccaatacc
ggaccggagcttatagtgcgctgcgaagccggaaccccggaagagctggagaggattaaa
gcagagttgtttgccttcctggaagtataa

DBGET integrated database retrieval system