KEGG   Syntrophomonas wolfei: Swol_2234Help
Entry
Swol_2234         CDS       T00396                                 

Definition
(RefSeq) 2-ketoacid ferredoxin oxidoreductase subunit beta
  KO
K00170  
pyruvate ferredoxin oxidoreductase beta subunit [EC:1.2.7.1]
Organism
swo  Syntrophomonas wolfei
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Nitrotoluene degradation
Propanoate metabolism
Butanoate metabolism
Methane metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:swo00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Swol_2234
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Swol_2234
   00020 Citrate cycle (TCA cycle)
    Swol_2234
   00620 Pyruvate metabolism
    Swol_2234
   00640 Propanoate metabolism
    Swol_2234
   00650 Butanoate metabolism
    Swol_2234
  Energy metabolism
   00680 Methane metabolism
    Swol_2234
  Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    Swol_2234
Enzymes [BR:swo01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.1  pyruvate synthase
     Swol_2234
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(2573678..2574616)
Genome map
AA seq 312 aa AA seqDB search
MATSIKKLPDIEQVLSGNGACGGCPATMALRIVGKALGSNAIMLLTPSCSVASMGMTPKL
GYNWPCINITFASAGSSASGITHALEVMQEKGRLQGELPTVFAWVGDGGTYDIGFQALSG
AAERNDNIIFFCYNNEAYSNTGVQRSGATPRGSFTTTTPTGKRQPKKNMALLMLEHNIPY
VATATVAYPGDLYDKVVKAKNIPGMKYIEIQAPCYLGWQFDMPETVQMSRMAVRSGAWLL
WEAENGKISFNNPSSLIISGKKDAAPVDEYLMKQGRFNRLLKGPDAESRIAEIQGDIDRE
IAFIRERAKITI
NT seq 939 nt NT seq  +upstreamnt  +downstreamnt
atggctaccagtattaaaaaattaccggatattgagcaggttttaagcggcaacggagcc
tgtggcggctgccccgccaccatggccttgcgcatcgtaggcaaggctctgggttcaaac
gccatcatgctgttgaccccctcctgttcggtagccagcatgggcatgacccccaagctg
ggttataattggccctgcattaatattacatttgcgtctgctggctcttcagcctccggt
attacccacgcgttggaagtaatgcaggaaaagggccgcctgcaaggcgagctgcctacc
gtattcgcctgggtaggcgatggcggcacctatgacatcggctttcaggccttatcaggc
gcagccgagcgcaacgataatatcattttcttttgctataacaacgaagcctacagcaac
accggtgtgcaacgcagcggagccaccccgcgcggcagcttcaccaccaccacccctacc
ggcaagcgccaacccaagaaaaacatggccctgctgatgttggagcacaatattccctat
gtggctactgccaccgtggcttaccccggcgacctgtacgacaaggtggtaaaagccaaa
aacatcccgggcatgaaatacatcgaaattcaggccccctgctatttaggttggcagttc
gatatgccggaaaccgtgcagatgagccgtatggctgtgcgcagcggtgcctggctgtta
tgggaagcagaaaatggcaagatcagctttaataaccccagctcgcttatcatcagcggt
aaaaaagacgctgctccggtggatgaatacttaatgaagcagggtcgcttcaaccgcctg
cttaaaggtcctgatgccgagagccgcattgccgaaattcaaggcgacatcgatcgcgag
attgcttttatacgggaacgagcgaagattacgatttag

DBGET integrated database retrieval system