KEGG   Syntrophomonas wolfei: Swol_2235Help
Entry
Swol_2235         CDS       T00396                                 

Definition
(RefSeq) 2-oxoisovalerate:ferredoxin oxidoreductase subunit alpha
  KO
K00169  
pyruvate ferredoxin oxidoreductase alpha subunit [EC:1.2.7.1]
Organism
swo  Syntrophomonas wolfei
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Nitrotoluene degradation
Propanoate metabolism
Butanoate metabolism
Methane metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:swo00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Swol_2235
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Swol_2235
   00020 Citrate cycle (TCA cycle)
    Swol_2235
   00620 Pyruvate metabolism
    Swol_2235
   00640 Propanoate metabolism
    Swol_2235
   00650 Butanoate metabolism
    Swol_2235
  Energy metabolism
   00680 Methane metabolism
    Swol_2235
  Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    Swol_2235
Enzymes [BR:swo01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.1  pyruvate synthase
     Swol_2235
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(2574658..2575788)
Genome map
AA seq 376 aa AA seqDB search
MKTAQVIMDTGAHAAALAVKSARVDVVPGYPITPQTSIMEALAAMVENGELHARFIPVEG
EHSSMAAAVAASAAGARVFTATSANGLLYMHEVLHMASGGRLPVVMCNVNRGIFAPWTLW
ADHQDSMAQRDTGWIQYHCSSNQEVFNTILQAFRVAEQINIPVMVNFDGFAISHCLMPLT
LPSQEDIDRFLPPYEPEWRLDPAHPSSFSNVTNAPEYAPFRQMLSDDIMASIPLVKQAAQ
EYKDITGMWDGDTIDTYRLEDAEVVAFAINSMGAELRLSIDILRQQGIKAGLVRPRLYLP
FPAEDIISALPQNAQVMVLDRNYNFGHPGGILAAELKSVLFGRRNDITVKNRVMGIGGID
LTRQFMAAEIRAMMDE
NT seq 1131 nt NT seq  +upstreamnt  +downstreamnt
atgaaaacagcacaagttattatggataccggtgcccatgccgccgcgctggccgtaaaa
agcgcccgggtggatgtagtacccggctaccctatcaccccccagaccagcattatggaa
gcgctggccgccatggtggaaaatggcgaactgcacgcccgtttcatcccggtggaaggc
gaacacagctccatggctgctgccgtagccgcatctgctgccggcgcccgcgtttttacc
gccacttcagccaacggcctgttgtatatgcacgaagttttacatatggcttccggagga
cgtttgccggtggtaatgtgtaatgttaaccgcggtatttttgccccctggaccctgtgg
gctgatcatcaggactcaatggctcagcgtgataccggctggattcaatatcactgctcc
tccaatcaggaggtgttcaacactattttgcaagccttccgcgtggccgaacagatcaat
atcccggtgatggtcaactttgacggctttgctatttcccattgtctgatgcccctcacc
ctgccgtcacaggaggatatcgaccgtttcttgcccccgtatgaaccggaatggcggctg
gacccggctcatccctcttccttcagcaatgtgaccaatgcacctgaatacgcacccttt
cgccagatgctgtccgatgatatcatggcatccatcccgctggtaaagcaggcagcgcag
gaatacaaggatatcaccggcatgtgggatggtgacaccatcgacacctatcgcttggaa
gacgccgaagtagtagcctttgccatcaacagtatgggagcagaattaagactttctatc
gatatccttcgccagcagggcatcaaagctggcctggtcagaccgcgcctgtatctgccc
ttcccggccgaggatatcataagtgcgctgccgcaaaatgcgcaggtgatggtactggat
cgtaattataactttggccaccccggcggtattttggctgcagagctgaaaagcgtgctc
tttggccgccgcaatgacatcacggttaaaaaccgggtaatgggcattggcggcatagac
ttgacccgccaattcatggccgccgagattcgtgccatgatggatgaatag

DBGET integrated database retrieval system