KEGG   Syntrophomonas wolfei: Swol_2236Help
Entry
Swol_2236         CDS       T00396                                 

Definition
(GenBank) pyruvate synthase delta chain
  KO
K00171  
pyruvate ferredoxin oxidoreductase delta subunit [EC:1.2.7.1]
Organism
swo  Syntrophomonas wolfei
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Nitrotoluene degradation
Propanoate metabolism
Butanoate metabolism
Methane metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:swo00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Swol_2236
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Swol_2236
   00020 Citrate cycle (TCA cycle)
    Swol_2236
   00620 Pyruvate metabolism
    Swol_2236
   00640 Propanoate metabolism
    Swol_2236
   00650 Butanoate metabolism
    Swol_2236
  Energy metabolism
   00680 Methane metabolism
    Swol_2236
  Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    Swol_2236
Enzymes [BR:swo01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.1  pyruvate synthase
     Swol_2236
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
complement(2575793..2576050)
Genome map
AA seq 85 aa AA seqDB search
MKSVTKAYRPISWPMKGAGGNTGSWRTHRPVVDTQICNKCQICWVYCPEAVIDRQEITID
YRYCKGCGVCAVECPTGAISMEMEE
NT seq 258 nt NT seq  +upstreamnt  +downstreamnt
atgaaatcagtaacgaaagcctaccggcccatttcctggccgatgaaaggagccggcggt
aacaccggttcctggcgaacgcatcgtccggtagttgacactcagatatgtaacaagtgc
cagatttgctgggtatattgtccggaagcggtcattgaccgccaagaaattactattgat
taccgctactgcaagggctgcggcgtatgcgccgtagaatgccccaccggcgcaatcagc
atggaaatggaggagtag

DBGET integrated database retrieval system