KEGG   Syntrophomonas wolfei: Swol_2357Help
Entry
Swol_2357         CDS       T00396                                 

Definition
glutamyl-tRNA synthetase
Orthology
K09698  
nondiscriminating glutamyl-tRNA synthetase [EC:6.1.1.24]
Organism
swo  Syntrophomonas wolfei
Pathway
Aminoacyl-tRNA biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:swo00001]
 Genetic Information Processing
  Translation
   00970 Aminoacyl-tRNA biosynthesis
    Swol_2357
Enzymes [BR:swo01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.24  glutamate---tRNAGln ligase
     Swol_2357
Amino acid related enzymes [BR:swo01007]
 Aminoacyl-tRNA synthetase
  Class I (A)
   Swol_2357
Transfer RNA biogenesis [BR:swo03016]
 Prokaryotic Type
  Aminoacyl-tRNA synthetases (AARSs)
   Other AARSs
    Swol_2357
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(2689694..2691166)
Genome map
AA seq 490 aa AA seqDB search
MCKGGNKVNKIKVRFAPSPTGPLHIGGARSALFNYLFASRYNGEMVLRIEDTDLERSRRE
YESEIIDSLKWLGLGWSEGIDTGGPNEPYRQTERLAIYQEYTKKLLEAGQAYYCFCSEKE
LEVERQDLLDSGQMQKYSGKCRQLSMAEREEKLKQGIKPAIRFKVPAHQLHIVDDLVRGR
VSFDSDDIGDFIIVKSDGIPTYNFAVVIDDVLMGISHVIRAEEHLSNTPRQLMIYDALNF
RRPEFAHISLILGSDRQKMSKRHGATSLVQYREMGYLPEALFNFLALMGWSPEGEEEILS
PAEITAAFSLERVAKSPAVFDINKLNFINQQYLKKIGDEELKEMLKPYLADSKYLKKIEQ
MGEERYELLVSTIRDYLVCLADVKEQLEVFFGDIDYAGDAREVLAGEGVIPLLQAFKEGI
HKVNKVEEIKQLIKGITKTLKLKPRDVFMPLRCALSGQAHGPDLSSYIAVIGGEEAIRRI
DRAIDFIKSQ
NT seq 1473 nt NT seq  +upstreamnt  +downstreamnt
gtgtgcaaaggaggcaataaagtgaataaaataaaagtcagattcgcccccagtcctacg
gggcccttgcatatcggcggtgcacgttcagccttattcaattaccttttcgcttcccgc
tataatggggaaatggttttgcgtattgaggatactgatttggaacgctcgcgccgggaa
tatgagagtgaaatcatcgattctttaaagtggttgggactaggctggtcggagggaatt
gacaccgggggacccaatgaaccttaccggcagaccgagcgcctagcaatataccaggaa
tataccaagaagctcctggaagcgggacaggcatattattgtttttgcagtgaaaaagaa
ctggaagtcgaaaggcaggatttactggatagtggtcagatgcaaaaatactcgggaaaa
tgccgccaattgagtatggcggaaagggaagaaaaactaaaacagggaatcaagccagct
atccgttttaaagtaccggcacatcagcttcatattgttgatgatctggtcagaggacgg
gtaagttttgatagcgatgatataggggatttcataatagtaaagtctgatgggatacca
acctataattttgcagtggttatagatgatgtactaatgggcatcagtcatgtaatccga
gccgaggagcacttgtcaaacacccctcgccaattgatgatttacgatgccctgaacttc
cggcgtcctgaatttgcccatatatctcttatcctcggtagtgaccgccagaagatgagc
aagcgccatggagccacatcgctggtgcagtaccgggaaatgggctatctgccggaggcc
ctattcaatttcctggctttaatgggctggtccccggaaggtgaagaggaaattctgagc
ccagcggaaattaccgccgccttttccctggaacgggtagccaaaagtccggcggttttc
gatattaataagctgaattttatcaaccagcagtatcttaaaaaaatcggggatgaagaa
ctgaaggaaatgcttaagccttacctggcagatagcaaatacctgaagaagatagagcaa
atgggtgaggaaaggtatgagcttttggttagtactataagagactacctggtttgcctg
gccgatgtgaaagagcagctggaagtttttttcggcgatattgactatgctggtgatgcc
cgggaagtactggcaggagaaggggttattccgttactgcaggcatttaaggagggaatc
cataaggtaaataaagtagaggagatcaagcagctaatcaaaggcattactaaaacactc
aaactcaagccccgggatgtatttatgcccctgcgctgtgccttgagcggccaggcccat
ggcccggacctatcctcgtatatagccgttattggcggagaggaagccataagaagaata
gatcgagctatagactttattaaaagccaatag

DBGET integrated database retrieval system