KEGG   Shewanella piezotolerans: swp_0145Help
Entry
swp_0145          CDS       T00791                                 

Definition
(GenBank) GTP cyclohydrolase I
  KO
K01495  GTP cyclohydrolase IA [EC:3.5.4.16]
Organism
swp  Shewanella piezotolerans
Pathway
swp00790  Folate biosynthesis
swp01100  Metabolic pathways
Module
swp_M00126  Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:swp00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    swp_0145
Enzymes [BR:swp01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.16  GTP cyclohydrolase I
     swp_0145
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GTP_cyclohydroI QueF
Motif
Other DBs
NCBI-ProteinID: ACJ26989
UniProt: B8CGZ6
Position
complement(151542..152180)
Genome map
AA seq 212 aa AA seqDB search
MDVPQAQQVRDALIEQGLETPLIPSDMTAEQKYERIKGLMTEVVSTLGLDLSDDSLQETP
HRIAKMYVNEIFSGLDYDNFPKIAQIENKMAVDEMVRITDISVVSTCEHHFVTIDGLARV
AYIPNRTIIGLSKINRIVRFFAQRPQVQERLTKQILVALQTLLATDNVAVSIDATHYCVK
SRGVMDTQSQTQTTALGGEFKTSAATRAEFFR
NT seq 639 nt NT seq  +upstreamnt  +downstreamnt
atggacgtacctcaggctcaacaagtgagagatgcattaatcgaacaaggactcgagacc
cctttaattccgtcggatatgaccgccgaacagaagtacgagcgcattaagggcttaatg
acggaagtggtttctaccttaggcctcgaccttagcgatgacagcttacaagagacgcca
caccgtattgccaagatgtatgtcaacgagatattttccggattagactatgataacttt
cctaaaattgcccagattgaaaacaaaatggcggttgacgagatggtacggatcactgat
atcagcgtcgttagcacctgcgagcatcactttgtaactatcgatggcctcgcaagagtg
gcctacattccgaaccgcaccattattggtctgtccaaaatcaaccgaatcgtgcgtttt
tttgcacagcgccctcaagtgcaggaacgtttaaccaagcaaatcttagttgccctgcaa
acattattggcaaccgataatgtcgcggtcagtattgatgctacccattactgcgtaaaa
tctagaggagtaatggatacccaatcgcaaacgcaaaccacagccctcggaggcgagttt
aaaactagcgccgcaactcgggcagagtttttccgctag

DBGET integrated database retrieval system