KEGG   Shewanella piezotolerans: swp_0200Help
Entry
swp_0200          CDS       T00791                                 

Definition
3'(2'),5'-bisphosphate nucleotidase
Orthology
K01082  
3'(2'), 5'-bisphosphate nucleotidase [EC:3.1.3.7]
Organism
swp  Shewanella piezotolerans
Pathway
Sulfur metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:swp00001]
 Metabolism
  Energy metabolism
   00920 Sulfur metabolism
    swp_0200
Enzymes [BR:swp01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.7  3'(2'),5'-bisphosphate nucleotidase
     swp_0200
Transfer RNA biogenesis [BR:swp03016]
 Eukaryotic Type
  tRNA degradation factors
   Rapid tRNA decay (RTD) pathway factors
    swp_0200
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
211217..212032
Genome map
AA seq 271 aa AA seqDB search
MKPESYIDQVIDIATEAGKKIRDIYQLGDFEREIKSDNTPVTSADIAAHNIIINALKELT
PEIPVLSEEDADIAFSERCNWQRYWLVDPLDGTGEFIAGSGDFSVIIALVEHNRPIVGVV
YVPMTEVCYYAIAGLGAYKRANGNEVRISSRQIGHDDDSPLRLAVSRRQDPQSVIKLFNQ
NKHCELVVLGGAALKSCLVAEGRADSYVRIGPTGEWDTGAAQIIVEEAGGQIMDLTLQPL
SYNERESLENPNFIVVGSPNLAWDEILIAES
NT seq 816 nt NT seq  +upstreamnt  +downstreamnt
atgaagccagagagttacatcgatcaagtcatagatatcgccactgaggcgggcaaaaaa
attcgtgatatttaccaacttggtgatttcgaacgcgagataaagtcagataataccccg
gtgacttcggcggatattgccgcacataatatcatcatcaacgcccttaaagagcttact
cctgagatccctgtcttatcggaagaagatgccgatatagcattctctgagcgttgtaat
tggcaacgttactggttggtcgacccactggatggaaccggagagtttattgccgggagt
ggtgatttctcggtgattatcgctctagttgagcataatcgccctatcgttggtgtagtg
tatgtgccgatgaccgaggtgtgttactacgcaattgctggtttaggtgcttataagcga
gccaacggcaatgaagtgcgcattagtagtcgtcaaattggtcacgatgacgatagccca
ttgaggctagcagtgagtcgccgccaagatcctcagtcggttattaagctgtttaaccag
aataagcattgcgaactggtggtacttggtggagcagcactaaaaagctgtttagtggca
gaaggacgtgcagacagttatgtacgtattggtcctaccggtgagtgggatactggcgct
gcacaaattattgtagaagaggcgggtggtcagatcatggatctcacgctgcaaccgttg
agctataacgagcgtgaaagcttggagaatccaaactttatcgttgttggctcgccaaac
ttggcctgggacgaaatcctaatcgctgaaagttaa

DBGET integrated database retrieval system