KEGG   Shewanella piezotolerans: swp_0289Help
Entry
swp_0289          CDS       T00791                                 

Definition
(GenBank) 3-oxoacyl-(acyl-carrier-protein) reductase
  KO
K00059  
3-oxoacyl-[acyl-carrier protein] reductase [EC:1.1.1.100]
Organism
swp  Shewanella piezotolerans
Pathway
Fatty acid biosynthesis
Biotin metabolism
Biosynthesis of unsaturated fatty acids
Metabolic pathways
Biosynthesis of antibiotics
Fatty acid metabolism
Module
Fatty acid biosynthesis, elongation
Brite
KEGG Orthology (KO) [BR:swp00001]
 Metabolism
  Lipid metabolism
   00061 Fatty acid biosynthesis
    swp_0289
   01040 Biosynthesis of unsaturated fatty acids
    swp_0289
  Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    swp_0289
  Biosynthesis of other secondary metabolites
   00333 Prodigiosin biosyntheses
    swp_0289
Enzymes [BR:swp01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.100  3-oxoacyl-[acyl-carrier-protein] reductase
     swp_0289
Lipid biosynthesis proteins [BR:swp01004]
 Fatty acid synthase
  Component type
   swp_0289
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(296630..297355)
Genome map
AA seq 241 aa AA seqDB search
MTKRILITGSSRGIGKAVALKLAESGFDIAMHYYQNISAAQETQHALEQLGVSVSCLKFD
IADRAAAKQAIEQDIEQHGAYYGVILNAGINCDTAFPAMTESEWDSVVHTNLDGFYNVIH
PTVMPMVQARQGGRIVTMASVSGIAGNRGQVNYSASKAGIIGATKALSLELAKRKITVNC
IAPGLIETDMVSDIPKDMVNSIVPMRRMGKASEIAGLANFLMSDDAAYITRQVISVNGGM
I
NT seq 726 nt NT seq  +upstreamnt  +downstreamnt
atgaccaaaagaatattaattaccggctctagccgcggtattggcaaggctgtcgcatta
aagcttgccgagtcagggtttgacatcgcaatgcattattatcaaaacattagcgccgca
caagagacccagcatgccctagagcagcttggggttagtgtatcttgtctcaagtttgat
attgccgatcgcgcagcagccaaacaagctattgagcaagatatcgaacaacatggcgcc
tattacggcgtaattttgaatgctggcataaactgtgacaccgcttttcctgcgatgacc
gagtcagagtgggacagcgtagtgcataccaaccttgatggtttttataatgttattcac
cctacagtgatgccgatggtacaagcaaggcaaggcggacgtattgtcaccatggcttca
gtctctggtattgcaggcaaccgcggccaagtaaactacagcgcctcaaaagccggcatc
attggcgcaaccaaagcgctgtctctagaactggcaaaacgtaaaatcactgtgaattgt
atcgctccaggacttatcgaaactgacatggtgtcagatattccaaaagatatggtcaac
tctattgtaccgatgcgacggatgggcaaagcctctgaaatagcaggactggctaacttc
ttgatgtcagatgatgctgcctatattacacgccaagtgatttcggttaatggaggcatg
atatga

DBGET integrated database retrieval system