KEGG   Shewanella piezotolerans WP3: swp_0289Help
Entry
swp_0289          CDS       T00791                                 

Gene name
fabG
Definition
3-ketoacyl-ACP reductase (EC:1.1.1.100)
Orthology
K00059  
3-oxoacyl-[acyl-carrier protein] reductase [EC:1.1.1.100]
Organism
swp  Shewanella piezotolerans WP3
Pathway
Fatty acid biosynthesis
Biotin metabolism
Biosynthesis of unsaturated fatty acids
Metabolic pathways
Fatty acid metabolism
Class
Metabolism; Overview; Fatty acid metabolism [PATH:swp01212]
Metabolism; Lipid metabolism; Fatty acid biosynthesis [PATH:swp00061]
Metabolism; Lipid metabolism; Biosynthesis of unsaturated fatty acids [PATH:swp01040]
Metabolism; Metabolism of cofactors and vitamins; Biotin metabolism [PATH:swp00780]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(296630..297355)
Genome map
AA seq 241 aa AA seqDB search
MTKRILITGSSRGIGKAVALKLAESGFDIAMHYYQNISAAQETQHALEQLGVSVSCLKFD
IADRAAAKQAIEQDIEQHGAYYGVILNAGINCDTAFPAMTESEWDSVVHTNLDGFYNVIH
PTVMPMVQARQGGRIVTMASVSGIAGNRGQVNYSASKAGIIGATKALSLELAKRKITVNC
IAPGLIETDMVSDIPKDMVNSIVPMRRMGKASEIAGLANFLMSDDAAYITRQVISVNGGM
I
NT seq 726 nt NT seq  +upstreamnt  +downstreamnt
atgaccaaaagaatattaattaccggctctagccgcggtattggcaaggctgtcgcatta
aagcttgccgagtcagggtttgacatcgcaatgcattattatcaaaacattagcgccgca
caagagacccagcatgccctagagcagcttggggttagtgtatcttgtctcaagtttgat
attgccgatcgcgcagcagccaaacaagctattgagcaagatatcgaacaacatggcgcc
tattacggcgtaattttgaatgctggcataaactgtgacaccgcttttcctgcgatgacc
gagtcagagtgggacagcgtagtgcataccaaccttgatggtttttataatgttattcac
cctacagtgatgccgatggtacaagcaaggcaaggcggacgtattgtcaccatggcttca
gtctctggtattgcaggcaaccgcggccaagtaaactacagcgcctcaaaagccggcatc
attggcgcaaccaaagcgctgtctctagaactggcaaaacgtaaaatcactgtgaattgt
atcgctccaggacttatcgaaactgacatggtgtcagatattccaaaagatatggtcaac
tctattgtaccgatgcgacggatgggcaaagcctctgaaatagcaggactggctaacttc
ttgatgtcagatgatgctgcctatattacacgccaagtgatttcggttaatggaggcatg
atatga

DBGET integrated database retrieval system