KEGG   Shewanella piezotolerans: swp_0289Help
Entry
swp_0289          CDS       T00791                                 

Gene name
fabG
Definition
3-ketoacyl-ACP reductase (EC:1.1.1.100)
Orthology
K00059  
3-oxoacyl-[acyl-carrier protein] reductase [EC:1.1.1.100]
Organism
swp  Shewanella piezotolerans
Pathway
Fatty acid biosynthesis
Biotin metabolism
Biosynthesis of unsaturated fatty acids
Metabolic pathways
Fatty acid metabolism
Module
Fatty acid biosynthesis, elongation
Brite
KEGG Orthology (KO) [BR:swp00001]
 Metabolism
  Overview
   01212 Fatty acid metabolism
    swp_0289 (fabG)
  Lipid metabolism
   00061 Fatty acid biosynthesis
    swp_0289 (fabG)
   01040 Biosynthesis of unsaturated fatty acids
    swp_0289 (fabG)
  Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    swp_0289 (fabG)
Enzymes [BR:swp01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.100  3-oxoacyl-[acyl-carrier-protein] reductase
     swp_0289 (fabG)
Lipid biosynthesis proteins [BR:swp01004]
 Fatty acid synthase
  Component type
   swp_0289 (fabG)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(296630..297355)
Genome map
AA seq 241 aa AA seqDB search
MTKRILITGSSRGIGKAVALKLAESGFDIAMHYYQNISAAQETQHALEQLGVSVSCLKFD
IADRAAAKQAIEQDIEQHGAYYGVILNAGINCDTAFPAMTESEWDSVVHTNLDGFYNVIH
PTVMPMVQARQGGRIVTMASVSGIAGNRGQVNYSASKAGIIGATKALSLELAKRKITVNC
IAPGLIETDMVSDIPKDMVNSIVPMRRMGKASEIAGLANFLMSDDAAYITRQVISVNGGM
I
NT seq 726 nt NT seq  +upstreamnt  +downstreamnt
atgaccaaaagaatattaattaccggctctagccgcggtattggcaaggctgtcgcatta
aagcttgccgagtcagggtttgacatcgcaatgcattattatcaaaacattagcgccgca
caagagacccagcatgccctagagcagcttggggttagtgtatcttgtctcaagtttgat
attgccgatcgcgcagcagccaaacaagctattgagcaagatatcgaacaacatggcgcc
tattacggcgtaattttgaatgctggcataaactgtgacaccgcttttcctgcgatgacc
gagtcagagtgggacagcgtagtgcataccaaccttgatggtttttataatgttattcac
cctacagtgatgccgatggtacaagcaaggcaaggcggacgtattgtcaccatggcttca
gtctctggtattgcaggcaaccgcggccaagtaaactacagcgcctcaaaagccggcatc
attggcgcaaccaaagcgctgtctctagaactggcaaaacgtaaaatcactgtgaattgt
atcgctccaggacttatcgaaactgacatggtgtcagatattccaaaagatatggtcaac
tctattgtaccgatgcgacggatgggcaaagcctctgaaatagcaggactggctaacttc
ttgatgtcagatgatgctgcctatattacacgccaagtgatttcggttaatggaggcatg
atatga

DBGET integrated database retrieval system