KEGG   Shewanella piezotolerans WP3: swp_1212Help
Entry
swp_1212          CDS       T00791                                 

Definition
dihydropteroate synthase (EC:2.5.1.15)
Orthology
K00796  
dihydropteroate synthase [EC:2.5.1.15]
Organism
swp  Shewanella piezotolerans WP3
Pathway
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:swp00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1217988..1218776
Genome map
AA seq 262 aa AA seqDB search
MGILNVTPDSFSDGGAYSSFERACLQADTMVEHGATFIDIGGESTRPGAKDVSVADELAR
VIPLIEYVSKHHDIWISIDTSKPEVMRAAVAAGAQLINDVRALQEPGALAAACELNVPVC
LMHMQGQPRTMQQAPIYADVVEDIAAFFKQRIEQCVQAGIKRDNIVLDPGFGFGKSLAHN
YEILQRFAEFDVFGLPLLAGMSRKSMFGQLLNRDVSQRLSASLAANMLALQAGADIVRVH
DVQETADMMAVLSATKNYKDLS
NT seq 789 nt NT seq  +upstreamnt  +downstreamnt
atggggatccttaacgttacccctgactctttttctgatggtggcgcatactcttcattt
gaaagagcctgccttcaagcagataccatggttgaacatggggcgacgtttattgatatt
ggtggcgagtctaccagacctggtgctaaagatgtaagcgtggccgatgagctcgcacga
gttattccgctaatagaatatgtatctaagcatcatgatatttggatctcgattgatacc
agtaagccagaagtaatgagagcagctgtcgctgctggtgcacagctcattaatgatgtt
agagccttacaagagcctggtgcattagcagcggcctgtgagcttaatgttcccgtatgc
cttatgcatatgcaagggcaacctcgtacgatgcagcaagccccaatctatgccgacgtt
gttgaagatatagcggcgttttttaagcagcgtatagaacaatgtgttcaagcaggtatt
aagcgtgacaatattgtgcttgatccaggatttggatttggtaaatcattagcgcataat
tatgaaatattacagcgctttgctgaatttgatgttttcgggcttcctttgttagcagga
atgtctcgaaaaagcatgttcggtcagttacttaatcgtgatgtatcacaaagattaagc
gcgtcgcttgctgctaatatgttagccctgcaggcgggagccgatatagtgcgtgtacat
gatgtacaggaaacagccgatatgatggctgtactcagcgcgacaaaaaattacaaggat
ttaagctag

DBGET integrated database retrieval system