KEGG   Shewanella piezotolerans: swp_1212Help
Entry
swp_1212          CDS       T00791                                 

Definition
dihydropteroate synthase (EC:2.5.1.15)
Orthology
K00796  
dihydropteroate synthase [EC:2.5.1.15]
Organism
swp  Shewanella piezotolerans
Pathway
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:swp00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    swp_1212
Enzymes [BR:swp01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.15  dihydropteroate synthase
     swp_1212
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1217988..1218776
Genome map
AA seq 262 aa AA seqDB search
MGILNVTPDSFSDGGAYSSFERACLQADTMVEHGATFIDIGGESTRPGAKDVSVADELAR
VIPLIEYVSKHHDIWISIDTSKPEVMRAAVAAGAQLINDVRALQEPGALAAACELNVPVC
LMHMQGQPRTMQQAPIYADVVEDIAAFFKQRIEQCVQAGIKRDNIVLDPGFGFGKSLAHN
YEILQRFAEFDVFGLPLLAGMSRKSMFGQLLNRDVSQRLSASLAANMLALQAGADIVRVH
DVQETADMMAVLSATKNYKDLS
NT seq 789 nt NT seq  +upstreamnt  +downstreamnt
atggggatccttaacgttacccctgactctttttctgatggtggcgcatactcttcattt
gaaagagcctgccttcaagcagataccatggttgaacatggggcgacgtttattgatatt
ggtggcgagtctaccagacctggtgctaaagatgtaagcgtggccgatgagctcgcacga
gttattccgctaatagaatatgtatctaagcatcatgatatttggatctcgattgatacc
agtaagccagaagtaatgagagcagctgtcgctgctggtgcacagctcattaatgatgtt
agagccttacaagagcctggtgcattagcagcggcctgtgagcttaatgttcccgtatgc
cttatgcatatgcaagggcaacctcgtacgatgcagcaagccccaatctatgccgacgtt
gttgaagatatagcggcgttttttaagcagcgtatagaacaatgtgttcaagcaggtatt
aagcgtgacaatattgtgcttgatccaggatttggatttggtaaatcattagcgcataat
tatgaaatattacagcgctttgctgaatttgatgttttcgggcttcctttgttagcagga
atgtctcgaaaaagcatgttcggtcagttacttaatcgtgatgtatcacaaagattaagc
gcgtcgcttgctgctaatatgttagccctgcaggcgggagccgatatagtgcgtgtacat
gatgtacaggaaacagccgatatgatggctgtactcagcgcgacaaaaaattacaaggat
ttaagctag

  All links  
No link information was found.   
DBGET integrated database retrieval system