KEGG   Shewanella piezotolerans: swp_1214Help
Entry
swp_1214          CDS       T00791                                 

Definition
(GenBank) Triosephosphate isomerase
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
swp  Shewanella piezotolerans
Pathway
swp00010  Glycolysis / Gluconeogenesis
swp00051  Fructose and mannose metabolism
swp00562  Inositol phosphate metabolism
swp01100  Metabolic pathways
swp01110  Biosynthesis of secondary metabolites
swp01120  Microbial metabolism in diverse environments
swp01130  Biosynthesis of antibiotics
swp01200  Carbon metabolism
swp01230  Biosynthesis of amino acids
Module
swp_M00002  Glycolysis, core module involving three-carbon compounds
swp_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:swp00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    swp_1214
   00051 Fructose and mannose metabolism
    swp_1214
   00562 Inositol phosphate metabolism
    swp_1214
Enzymes [BR:swp01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     swp_1214
Exosome [BR:swp04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   swp_1214
  Exosomal proteins of bladder cancer cells
   swp_1214
  Exosomal proteins of melanoma cells
   swp_1214
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TIM
Motif
Other DBs
NCBI-ProteinID: ACJ28008
UniProt: B8CKG9
Position
1220382..1221164
Genome map
AA seq 260 aa AA seqDB search
MALRRPMVAGNWKMNGSAQLAQELFKKFATKLQNDSAEVVLCPPSIYLESVRQLLDENKE
ALNGCLVRMGTQNVSQHDFGAYTGEISGQMLKDSGCRYVIIGHSERRRMYGETSDIVAEK
FAAAQKHGLTPILCVGESGPAREARRTFEVIAEELDVVIEKNGTMAFDNAIIAYEPLWAV
GTGKSATPEQAQEVHAFIRKRLSEVSPFIGENIRILYGGSVTPSNAADLFAQPDVDGGLI
GGVSLNATEFLSLCTIAMSA
NT seq 783 nt NT seq  +upstreamnt  +downstreamnt
atggcactaagacgtcccatggtcgctggtaattggaaaatgaatggcagtgcgcaactc
gcgcaagagctattcaaaaaattcgctaccaagctccaaaatgattcagcggaagtagtt
ttgtgtccgccttctatttatttagaaagtgttcgacagctgctagatgaaaataaagaa
gccttaaatggttgtcttgtcagaatgggtacgcagaatgtcagtcaacatgacttcggt
gcttatactggtgaaatatctgggcagatgttaaaagattcaggatgccgatatgttatt
attggccattcagaacgtcgccgtatgtacggagagacgagtgacatagtagcagagaaa
tttgctgcagctcaaaaacatggtttgacgccaatcttatgtgttggtgagtcaggtcca
gctcgtgaagcaagacgtacttttgaagttattgctgaagagttagacgtggtcattgaa
aaaaatggcaccatggcttttgacaacgcaattatcgcttacgagccattatgggcagta
ggaacaggtaagagcgctacgccagagcaggcacaggaagttcatgcgtttattcgcaaa
cgcctctctgaagtatctccatttatcggagaaaatatcaggattttgtacggtggtagc
gtaacaccgagtaacgcagcagatttatttgcgcagcctgatgtagacggtggcttgatt
ggcggtgttagcctcaatgctactgaatttctcagtctatgtacgatagcgatgagcgca
taa

DBGET integrated database retrieval system