KEGG   Shewanella piezotolerans: swp_1214Help
Entry
swp_1214          CDS       T00791                                 

Definition
triosephosphate isomerase (EC:5.3.1.1)
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
swp  Shewanella piezotolerans
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:swp00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    swp_1214
   01230 Biosynthesis of amino acids
    swp_1214
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    swp_1214
   00051 Fructose and mannose metabolism
    swp_1214
   00562 Inositol phosphate metabolism
    swp_1214
Enzymes [BR:swp01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     swp_1214
Exosome [BR:swp04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   swp_1214
  Exosomal proteins of bladder cancer cells
   swp_1214
  Exosomal proteins of melanoma cells
   swp_1214
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1220382..1221164
Genome map
AA seq 260 aa AA seqDB search
MALRRPMVAGNWKMNGSAQLAQELFKKFATKLQNDSAEVVLCPPSIYLESVRQLLDENKE
ALNGCLVRMGTQNVSQHDFGAYTGEISGQMLKDSGCRYVIIGHSERRRMYGETSDIVAEK
FAAAQKHGLTPILCVGESGPAREARRTFEVIAEELDVVIEKNGTMAFDNAIIAYEPLWAV
GTGKSATPEQAQEVHAFIRKRLSEVSPFIGENIRILYGGSVTPSNAADLFAQPDVDGGLI
GGVSLNATEFLSLCTIAMSA
NT seq 783 nt NT seq  +upstreamnt  +downstreamnt
atggcactaagacgtcccatggtcgctggtaattggaaaatgaatggcagtgcgcaactc
gcgcaagagctattcaaaaaattcgctaccaagctccaaaatgattcagcggaagtagtt
ttgtgtccgccttctatttatttagaaagtgttcgacagctgctagatgaaaataaagaa
gccttaaatggttgtcttgtcagaatgggtacgcagaatgtcagtcaacatgacttcggt
gcttatactggtgaaatatctgggcagatgttaaaagattcaggatgccgatatgttatt
attggccattcagaacgtcgccgtatgtacggagagacgagtgacatagtagcagagaaa
tttgctgcagctcaaaaacatggtttgacgccaatcttatgtgttggtgagtcaggtcca
gctcgtgaagcaagacgtacttttgaagttattgctgaagagttagacgtggtcattgaa
aaaaatggcaccatggcttttgacaacgcaattatcgcttacgagccattatgggcagta
ggaacaggtaagagcgctacgccagagcaggcacaggaagttcatgcgtttattcgcaaa
cgcctctctgaagtatctccatttatcggagaaaatatcaggattttgtacggtggtagc
gtaacaccgagtaacgcagcagatttatttgcgcagcctgatgtagacggtggcttgatt
ggcggtgttagcctcaatgctactgaatttctcagtctatgtacgatagcgatgagcgca
taa

DBGET integrated database retrieval system