KEGG   Shewanella piezotolerans WP3: swp_1292Help
Entry
swp_1292          CDS       T00791                                 

Definition
alkaline phosphatase (EC:3.1.3.1)
Orthology
K01077  
alkaline phosphatase [EC:3.1.3.1]
Organism
swp  Shewanella piezotolerans WP3
Pathway
Aminobenzoate degradation
Folate biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Two-component system
Module
Tetrahydrofolate biosynthesis, GTP => THF
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:swp00790]
Metabolism; Xenobiotics biodegradation and metabolism; Aminobenzoate degradation [PATH:swp00627]
Environmental Information Processing; Signal transduction; Two-component system [PATH:swp02020]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1304921..1306555)
Genome map
AA seq 544 aa AA seqDB search
MNKKLLVLSIAAMLGLAACGSDGDNGADGSNGNDGSNGGNGSNGQDWTAANQWFIDGQAR
VAKADGLTVENQAGAAKNIILFVGDGMGVSTVTAARILEGQLKGQTGEENSLSFETLPYL
GLAKTYNVDGQTPDSAGTMTAMVTGVKTDVGVLSQAEGVSRGNCASTAGQNLVTSLELAA
MAGLSTGVVSTARITHATPAATYAHAPERNWESDADLPAEAVTNGCKDIASQLLDFDFGN
GLNVVMGGGRRAFIPNTMTDPEGKSGKRLDNRNLTDEWLAKYNNAAYVTDRDSFLTLDPS
STDHALGLFNSSHMEYDFDRTTTGVTGEPSLAEMTAKSIDILQKNDKGFVLIIEAGRIDH
AHHAGNAARALHDTIALSEAVRIAMEKTSEKDTLLMVTADHSHVFTIAGYPTRGNPILGL
VKGNGSDGLPAITNATDSNGLPYTTVGYANGLGYASLATGGDERYGYAAAPGRFDLNYVD
TQHAGFHQEALVPLGSETHAGEDVGIFASGPGSHLVQGTVEQNHIFHVMNHAASLVEKAA
AMQP
NT seq 1635 nt NT seq  +upstreamnt  +downstreamnt
atgaacaagaaattactcgtactttcgattgcagcaatgcttggtttagcagcttgtggc
agcgatggtgataacggcgctgatggtagcaacggaaatgatggcagcaatggtggaaat
ggtagcaacggccaagactggaccgcagctaaccagtggtttattgacggacaagcaaga
gtcgcaaaagccgatggcttaaccgttgaaaaccaagctggagcagccaagaatattatt
ctatttgtaggcgatggtatgggcgtatcaaccgtcactgcagcacgcattttagaaggg
caattgaaaggacaaaccggtgaagaaaactcactatcgtttgaaaccttgccttactta
gggctagccaagacctataatgttgatggtcaaacaccggattcggcgggcactatgact
gcaatggttacaggtgtaaaaactgatgtaggtgtgctgtcgcaagcggaaggcgtcagc
cgtggcaactgcgcttcaaccgccgggcaaaaccttgtcacctcacttgaacttgcggca
atggcagggttgtcaactggtgtagtctctacagcgcgcatcactcatgcaacccctgca
gcaacttatgcccacgctcctgagcgcaactgggagagcgatgcagatctgccagctgag
gcagtaacaaatggctgtaaggacatcgcatcacaactgctcgactttgactttggtaac
gggctcaatgtggtcatgggtggaggtcgacgcgcgtttattccgaacacaatgacagat
cccgaaggaaaatcaggtaaacgcctcgataatcgaaacctaactgatgaatggttagca
aagtacaacaacgcggcttatgtgaccgacagagacagctttctaacacttgatccaagc
agcacagatcacgccttagggttattcaactcctctcacatggaatatgactttgatcgc
accactaccggcgtgacaggtgaaccatctcttgctgaaatgaccgcgaaatcaattgat
attctgcaaaagaatgacaaaggatttgtgcttatcattgaagcgggtcgtatcgaccac
gcccaccatgcaggtaatgctgcccgtgctttacatgacactatcgcgctgtctgaagcg
gtacgcattgcgatggaaaaaacctcagagaaagatacgttactaatggtcaccgctgac
cacagccacgtatttaccattgcaggttaccctacccgcggcaacccaattctaggtctg
gtaaaaggtaacggttcagatggtctacctgccatcacgaatgctacagactctaacggc
ttgccatacacaactgttggctacgctaacggcttaggctatgccagcttagcaactggt
ggcgatgagcgatacggctacgctgctgcgccaggtcgcttcgatctgaattacgtagac
acccaacatgcaggtttccatcaagaggcactcgtgccactgggcagcgaaactcatgct
ggtgaagatgttggtatattcgccagcggtcctggttcacaccttgttcaaggcacggtt
gagcaaaaccacatcttccacgtaatgaaccacgctgcaagcttagtagaaaaagctgca
gcgatgcagccgtaa

DBGET integrated database retrieval system