KEGG   Shewanella piezotolerans: swp_1312Help
Entry
swp_1312          CDS       T00791                                 

Definition
4-alpha-glucanotransferase (EC:2.4.1.25)
Orthology
K00705  
4-alpha-glucanotransferase [EC:2.4.1.25]
Organism
swp  Shewanella piezotolerans
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:swp00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    swp_1312
Enzymes [BR:swp01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.25  4-alpha-glucanotransferase
     swp_1312
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1322624..1324984
Genome map
AA seq 786 aa AA seqDB search
MGLKKLLYLQGVGAEFVSCSGDNIVTPEQDRIGILRCMLASAAQERCEPVMSAEQIDEKI
YQLDAEPWTQRLPLFQHTRIDNPELSVFLPSDSDSRLTIELQLEGGEPFQLGIDTAKFAA
NPHIAKVTGHYHVDDCDYLHYRLLITQALLASDIYCGGSLQMSVLPDIGLGYHRVRIRDQ
AEFVEGQWLVAPVMSYQSGNTRSPSNSRLWGLSIQLFSLRSETQWGIGDFADLAALIELV
ANEGGSFIQLNPLHALDIANPQACSPYSPSDRRRLNPLYINFEMVPEYSQLFCDVEPNAA
GATSSELAIKFKAIKRQVNRADWLDYQLVSLHKYRIFKLLYQQFIVAHVETNSARGQQFS
LFITDNGDSLRQFCEQQLSDTVGLSEFSGLDSRFFAYLQFVAEQQLSQCQAQAKRLGMAI
GLVRDMAVGVASNSVEVRADNSPFCQDASIGAPPDPFAPQGQNWGLTPFDPIALKHDGYQ
HFIQLLRSNMQSCGALRIDHVMSLLRLWWWPRSKELGNGAYVYYPLDVLLAIVCIESQRA
QCLIIGEDLGLIPPEIVSKLAAAGVLSNDLFYFSKEGDGFTLPANYPADSLMMLANHDVP
PLLAWWQADDLQLRRSIGLIDNDELLQSLISQREFDKQQLLKLLQAQGQFDGSDVNSIHY
PELLKAWLAVTAAGNAHLFSVQLFDLVCDNQPINIPGTWLQYPNWQRRLALSLTELAADK
QVQGLLLQLQTSRQQGVQSERETDAYARTHACTKANTTTTTSTHPNRTTSTPAHATSSLQ
PNGLPL
NT seq 2361 nt NT seq  +upstreamnt  +downstreamnt
atggggttaaaaaagttactgtatttgcaaggcgttggtgctgagtttgtcagctgtagt
ggcgataacatcgtaaccccagagcaagatcgtattggtattttgcgctgtatgctggct
agcgctgcacaagagcgatgcgaacctgtgatgtcggcggagcagatagacgaaaaaatc
taccaacttgatgcggagccgtggactcaacggttgcctttgtttcaacatacaaggata
gataatcccgagttgagtgtgttcctccctagtgacagtgactctcgattgacgattgag
ctgcagttagagggcggtgagccgtttcagttaggtatcgatacagctaagtttgctgca
aaccctcatattgccaaggttacaggccattaccatgtcgatgattgcgactatttgcac
tatcgactgttgatcactcaagcattgttggcgtctgatatctactgcggcggttcatta
caaatgtcagttttgccagatataggtctgggctatcatcgggtgcgcattcgtgatcaa
gctgagtttgttgaaggtcagtggttagtcgctcccgtaatgagttaccaaagcggcaat
actcgttcacctagcaatagccgtttatgggggctcagtattcaactatttagccttcgc
agtgagacgcaatggggcattggtgattttgccgatttagcagcgcttattgagctggtg
gctaacgagggcggcagctttattcaactcaatccgttacatgctctggatattgccaac
cctcaagcatgtagcccttatagtccatctgataggcgcaggcttaacccgctttatatt
aactttgaaatggtgcctgagtattcacagttattttgcgatgtggagcctaatgctgca
ggtgcaacatcatctgagctagccattaaatttaaagcaataaagcggcaggtcaatcgt
gccgattggctcgattatcaactggtaagtctacataaataccggatttttaaactgctt
tatcagcaatttatagtggctcatgttgaaactaatagtgcaagagggcagcaatttagt
ctgtttattactgataatggcgatagtttgcggcagttttgtgagcagcagcttagtgat
accgtcggcttgagtgaattttctgggctagatagtcgcttttttgcttacctgcagttt
gtcgctgagcagcaattaagccaatgccaagcccaagcaaaacgattggggatggcgatt
ggactggttcgcgacatggcggttggggtggcttccaatagtgttgaagttcgagcagat
aacagccctttttgccaagatgccagtattggtgcgccgccagatccatttgctccccaa
gggcaaaactggggcttaacaccctttgaccctattgcgctaaagcacgacggctatcag
cattttatccagttattgcgcagtaatatgcaatcatgcggtgcactgagaattgaccat
gttatgtcgctactgcgtttgtggtggtggccaagatcaaaagaattaggtaacggcgcc
tatgtttattatccacttgatgtgttgttggctattgtgtgtattgaaagtcagcgcgct
caatgtttaattatcggtgaagacttaggcctaattcctcctgaaattgttagtaaactt
gcggctgcgggcgtgttatctaacgatctgttttactttagcaaagagggtgatggtttc
accttgccagcaaactatccagcagacagtttaatgatgttagccaatcacgatgttcct
ccgttattagcgtggtggcaagcagatgatctgcagctcagacgtagtatcggtcttatt
gataatgatgagttgctgcaatcgctgatatcacagcgtgagttcgataaacagcagtta
ttgaaattactgcaggcgcaaggtcagtttgacggcagcgatgtaaatagcattcattac
cctgaactacttaaggcttggttggcggtcactgctgctggtaacgcgcatcttttcagc
gtgcaacttttcgatttggtctgtgataaccaacctattaatatccccggtacctggctg
caatatcctaattggcagcgccgattagcactatctttaaccgagttagcagcagataaa
caagtgcaaggattgctactgcagttacaaacttctcgtcagcaaggtgtgcagagtgag
cgggaaaccgatgcatatgcaagaacacacgcctgcacaaaagccaataccactaccact
accagtactcatcccaatcgcacgacttcaacaccagctcatgcaacttcgtcactacaa
ccaaatggattaccgctatga

DBGET integrated database retrieval system