KEGG   Shewanella piezotolerans: swp_1362Help
Entry
swp_1362          CDS       T00791                                 

Definition
protein-L-isoaspartate(D-aspartate) O-methyltransferase (EC:2.1.1.77)
Orthology
K00573  
protein-L-isoaspartate(D-aspartate) O-methyltransferase [EC:2.1.1.77]
Organism
swp  Shewanella piezotolerans
Brite
Enzymes [BR:swp01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.77  protein-L-isoaspartate(D-aspartate) O-methyltransferase
     swp_1362
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1382048..1382683
Genome map
AA seq 211 aa AA seqDB search
MDRLASTSALNLARSLYEAGIRDEPVLKAVANTPRERFLDAALGHKAYENTALPIGQGQT
ISQPYIVARMTEILLQCQPQKVLEIGTGSGYQAAILAQLVPQLCTVERIKSLQIQARQRL
KKLDLHNIAFKYGDGWQGWPSKGPYDAIMVTAAAASVPNALTEQLTDGGVLVIPVGEASQ
QLLKVTRKGNQYVSEAIEIVRFVPLINGELA
NT seq 636 nt NT seq  +upstreamnt  +downstreamnt
atggatcggctcgcgtcaacatcggctttaaacctagcaagaagtttatatgaagcaggt
attcgtgatgagccggtcttaaaagcggtagccaatacgcccagagagcggtttttagat
gcggctttaggacataaagcttatgagaataccgccttgcctattgggcaagggcagaca
atatcgcaaccctatattgttgcgagaatgactgaaattctactgcagtgtcaacctcaa
aaagtgctagaaattggcacgggttctggttaccaagcggcaatattggcgcaactggtt
ccccaactttgtactgtagagcgtataaagagcttacaaatacaagctagacaacgttta
aagaagctagatttacataatatagcttttaaatacggtgatggctggcagggctggccg
agtaaaggcccatatgatgcaattatggtgactgcagcagcggcaagcgtgccgaatgca
ttaacagagcagttgacggatggtggagtactggttattcctgtaggggaagcttcacaa
caactacttaaagtcactcgtaagggcaatcagtacgtctcagaggctatagaaatcgtt
cggtttgtaccgttaatcaatggcgagcttgcctga

DBGET integrated database retrieval system