KEGG   Shewanella piezotolerans: swp_1433Help
Entry
swp_1433          CDS       T00791                                 

Definition
(RefSeq) malate synthase (EC:2.3.3.9)
  KO
K01638  
malate synthase [EC:2.3.3.9]
Organism
swp  Shewanella piezotolerans
Pathway
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:swp00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    swp_1433
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    swp_1433
   00630 Glyoxylate and dicarboxylate metabolism
    swp_1433
Enzymes [BR:swp01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     swp_1433
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1465906..1467531
Genome map
AA seq 541 aa AA seqDB search
MTDQITMDNGITADEIVINADPVKGQETVLTEGALSLLKTLCKHFAADVPTLLANRKVKQ
ALIDNGQLPDFLPETKSLRENEWKVRGIPNDLQDRRVEITGPVDRKMVINALNANAKVFM
ADFEDSLAPSWQKIVAGQINLRDAVAGDISYIAAETGKLYTLDDDPAVLICRVRGLHMLE
KHVSFAEQAIPASLFDFCIYFYNNYRQLLSKGSGPYFYIPKLESHLEARWWAKVFAFVEE
RFCLQPGTIKCTCLIETLPAVFEMDEILFELRSNIVALNCGRWDYIFSYIKTLNRYSDRI
LPDRQSVTMDTPFLSAYSRLLVKTCHKRGALAMGGMAAFIPSKDANENQQNLDKVRQDKQ
LEARNGHDGTWVAHPGLADTAMEIFNEYIGEDHVNQLHITRDVDAPILAHELLAACDGAR
TEIGMRRNIRIALQYTEAWINGNGCVPIYGLMEDAATAEIARTSIWQWIKHSQHLSNGVL
VTKALFKEMLVQELAQVKEEVGAARFTHGRFTEAAVILEQITTADELVDFITQPGYELLV
S
NT seq 1626 nt NT seq  +upstreamnt  +downstreamnt
atgacagatcaaataacaatggataacggtattacagcagacgagattgttatcaatgca
gatcctgtcaaaggacaagaaacggtattaacagaaggcgcactgagtttattaaaaacc
ttatgcaagcattttgctgctgatgtgccaaccttgctggcaaacagaaaggttaaacaa
gctttaatcgataacggacagttacctgactttctaccagaaacaaaatcattgcgagag
aatgagtggaaagttagagggatccccaacgaccttcaagataggcgtgttgagatcaca
gggcctgtcgatcgaaaaatggtgatcaatgcacttaatgccaatgcaaaagtatttatg
gctgactttgaagattctctagcgccgagttggcagaagatagttgctgggcaaatcaat
ttacgtgatgcagtggctggtgatatcagttatatcgctgcagaaacaggcaaattatac
acattagatgatgaccccgcggtgcttatttgccgagttagaggactgcatatgctagaa
aaacatgtcagttttgcagagcaagcgattccagccagcctatttgatttttgtatctat
ttttataataactatcgccaactattgagcaagggcagtggcccttacttctatatcccc
aagctagaaagccatcttgaagcacgatggtgggctaaggtatttgcttttgttgaggag
cgcttttgtcttcaaccaggcaccattaaatgtacatgtcttattgagactttacctgct
gtttttgagatggatgagatcctatttgaactgcgctcaaacatcgttgcgctgaactgt
ggacgttgggattacatttttagctatattaaaacgctgaatcgctatagcgaccgcata
ttgccggacagacagtcagtcacaatggatacgccttttcttagcgcttactcacgtttg
ctggttaaaacttgtcataaacgtggcgcgttagcgatgggcggaatggcggcattcatt
ccgtctaaggatgcaaacgaaaaccagcagaacttagataaagtgcgtcaagataaacag
ctagaagcgcgcaatggccatgatggtacttgggttgctcatccgggattagctgatacc
gcaatggagatcttcaatgagtatattggcgaagatcatgttaaccagctgcatatcact
cgtgatgtggatgcacccattctagcccatgaattgttggctgcttgcgatggtgcgcga
actgaaataggaatgcgccgaaatattcgtattgccctgcaatacactgaggcatggatc
aacggaaatggctgtgtgccaatctatggactgatggaagatgcggctactgccgaaatt
gccagaacctctatatggcaatggatcaagcattcacagcacttatctaacggtgtgtta
gtgactaaagcactgtttaaagagatgttagtacaagagcttgcacaggtaaaagaggag
gtgggggcagcaaggtttacccatggtcgttttaccgaagctgcagttattcttgaacaa
ataactactgcagatgagttggtagattttattactcaacctggttacgagttgcttgtt
agctga

DBGET integrated database retrieval system